BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20727 (514 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.3 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 4.3 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 7.5 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 7.5 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 9.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 9.9 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 311 FIALHASSASCKFSNSMKANLG 246 F+A A+C+FS +A LG Sbjct: 458 FLATVVEEAACRFSAVAQAQLG 479 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 30 FLFINVFKISQNR 68 FL+ N+FK +NR Sbjct: 361 FLYYNIFKALRNR 373 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 4.3 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 383 GSEVGAAVTS---GVVVHSEVREEAGLTTHTVAAAAGRTIVTETDWL 514 G+ AA T V V S V AG AAAG+ DWL Sbjct: 43 GTSTTAAATPTPPSVPVGSAVAGTAGGALFPGMAAAGKGAARSDDWL 89 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 395 GAAVTSGVVVHSEVREEAGLTT 460 G + +G+ VH ++AG+ T Sbjct: 289 GIVLATGITVHRNSAQQAGVGT 310 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 395 GAAVTSGVVVHSEVREEAGLTT 460 G + +G+ VH ++AG+ T Sbjct: 289 GIVLATGITVHRNSAQQAGVGT 310 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 20.6 bits (41), Expect = 9.9 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +2 Query: 179 KEDLEREFDKYGKL 220 +++ +R F+KYG+L Sbjct: 182 EQEAKRRFEKYGQL 195 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 216 FPYLSNSRSRSSFLIP 169 FPYL +FLIP Sbjct: 7 FPYLCYKNGGGAFLIP 22 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,794 Number of Sequences: 438 Number of extensions: 1940 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -