BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20726 (681 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0323 - 24392043-24393021,24393135-24393544 32 0.37 05_02_0146 + 7076818-7077264 30 2.0 03_02_0390 + 8056006-8057502 30 2.0 02_02_0453 + 10420585-10421661,10422015-10422146,10422232-104224... 30 2.0 12_01_0320 + 2444131-2444586 29 3.4 11_01_0314 + 2339241-2339728,2342720-2343608 29 3.4 05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98... 29 3.4 08_02_1092 + 24267737-24268641,24269005-24269884 29 4.5 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 29 4.5 05_05_0277 + 23780779-23781103,23781954-23782363,23782487-237830... 29 4.5 02_01_0775 + 5775949-5777385 29 4.5 01_06_0301 + 28315919-28316987,28317059-28317743,28317751-28318246 29 4.5 01_01_0522 - 3834551-3835451,3835992-3836572 29 4.5 05_05_0219 + 23371561-23371680,23371799-23372207,23374520-233746... 28 6.0 05_03_0086 + 8279518-8280320,8280923-8281844 28 6.0 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 28 6.0 01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298... 28 6.0 09_02_0104 - 4329068-4329926,4330967-4331811 28 7.9 06_03_1482 + 30441670-30441758,30441848-30441959 28 7.9 05_03_0458 + 14280953-14281866,14281964-14282912 28 7.9 >04_04_0323 - 24392043-24393021,24393135-24393544 Length = 462 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 10 RRMKEHVFFAGIDWQQVYHQKYTPPLIPP 96 R +K H FF G+DW ++ + PP IPP Sbjct: 369 RGIKAHPFFNGVDWDRIL-RVARPPFIPP 396 >05_02_0146 + 7076818-7077264 Length = 148 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 489 RRFPPTSFHQGRAVHRAANPKRHQGRAHEYGRDRPEGVGLSLRSAHKCSKNSLP-RWRRK 665 RR PP F A AA +R +G + G DR +++ A + + LP + R+ Sbjct: 74 RRLPPPLFSSPDAPSPAAGRRRRKGEDEDDGEDRRRRYHVNVGDAIRALREELPAAFYRE 133 Query: 666 PA 671 P+ Sbjct: 134 PS 135 >03_02_0390 + 8056006-8057502 Length = 498 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIPPR 99 +K H FFAG+DW + + PP++P + Sbjct: 410 IKRHPFFAGVDWALI--RCVAPPVVPDK 435 >02_02_0453 + 10420585-10421661,10422015-10422146,10422232-10422456, 10422555-10422680,10422777-10422839,10423214-10423296, 10424078-10424309,10424421-10424489,10424532-10424731, 10424819-10424894,10425015-10425081,10425194-10425471, 10425600-10425787,10426235-10426391,10426496-10426741 Length = 1072 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPP 84 +K H +F GIDW+Q+ YT P Sbjct: 1009 VKRHPWFDGIDWKQIADGTYTVP 1031 >12_01_0320 + 2444131-2444586 Length = 151 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIPP 96 +K H FF+G++W + + TPP +PP Sbjct: 97 IKRHPFFSGVNWALL--RCATPPYVPP 121 >11_01_0314 + 2339241-2339728,2342720-2343608 Length = 458 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIPP 96 +K H FF+G++W + + TPP +PP Sbjct: 400 IKRHPFFSGVNWALL--RCATPPYVPP 424 >05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-986919, 987020-987059,987751-987857 Length = 323 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +3 Query: 501 PTSFHQGRAVHRAANPKRHQGRAHEYGRDRPEGVGLSLRSAHKCSKNSLPRWRRKPARS 677 P + + R+ + +P+R +GR+ Y R R S RS + S + PR RR+ RS Sbjct: 143 PRNLRRERSYSCSPSPRRGRGRSRSYSRSRSRSRSYS-RSRSR-SLSGSPRARRELERS 199 >08_02_1092 + 24267737-24268641,24269005-24269884 Length = 594 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIP-PRGRSTPPMPS 126 +K+H FF G++W + + +PP IP P PP P+ Sbjct: 535 IKQHPFFEGVNWALI--RCASPPEIPKPVELERPPKPA 570 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +1 Query: 466 NDSAGHCRGGFLRLLSIKGEQCIVLRTRNDTKVVLTNTDEIGL 594 +D +GG LR ++G +V RNDT V+L DE+GL Sbjct: 586 DDQPEWLKGGKLRDYQLEGLNFLVNGWRNDTNVIL--ADEMGL 626 >05_05_0277 + 23780779-23781103,23781954-23782363,23782487-23783016, 23785904-23785991 Length = 450 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 34 FAGIDWQQVYHQKYTPPLIPPRGRSTPPMP 123 F G+ W Y T P PR R T P P Sbjct: 154 FFGLSWHSEYRMHETAPTSLPRSRFTTPHP 183 >02_01_0775 + 5775949-5777385 Length = 478 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +2 Query: 428 RLELHLENSAKPEMILLDTVEEVSSD 505 +L++ +S+KP M+L++TVEE+ D Sbjct: 217 QLDIDRRSSSKPPMVLVNTVEELELD 242 >01_06_0301 + 28315919-28316987,28317059-28317743,28317751-28318246 Length = 749 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 6 APTNEGARFLRWHRLAAGLPPEVHSATDTAAREVNAAD 119 AP ++ AR H + PP + D AAR V A+D Sbjct: 571 APPHDRARLFLRHARRSSAPPRAMAVYDEAARSVPASD 608 >01_01_0522 - 3834551-3835451,3835992-3836572 Length = 493 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIPPRGRSTPPMPSTLEASTKKTP 156 +K H FF G++W V + PP +P P T+ ++ P Sbjct: 437 VKRHPFFKGVNWALV--RSVRPPEVPAPPAPAPKKVMTMSKKERQEP 481 >05_05_0219 + 23371561-23371680,23371799-23372207,23374520-23374635, 23375385-23375855 Length = 371 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 64 HQKYTPPLIPPRGRSTPPMPSTLEASTKK 150 H + PP PP+ ++ PP P+ E+ +K Sbjct: 71 HHQTPPPAKPPKDQTPPPPPAVSESKGQK 99 >05_03_0086 + 8279518-8280320,8280923-8281844 Length = 574 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIP 93 +K+H FF G++W V + TPP +P Sbjct: 496 IKQHPFFDGVNWALV--RSLTPPSVP 519 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 79 PPLIPPRGRSTPPMPSTLEASTKKTPKELS*QKRIRCNTRTSLW*YRNV 225 PP +PP PP P TL A+ P+E ++R R R YR + Sbjct: 44 PPGVPP---PPPPPPQTLAAAASPRPEEAVRKRRNREELRGLFECYRRI 89 >01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668, 2986798-2986893,2987003-2987042,2987760-2987887 Length = 305 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +3 Query: 510 FHQGRAVHRAANPKRHQGRAHEYGRDRPEGVGLSLRSAHKCSKNSLPRWRRKPARS 677 + +GR+ R+ +P+R + R Y R R S +S + S+N R R P S Sbjct: 134 YRRGRSYSRSPSPRRGRSRGRSYSRSRSRSYSRS-QSPRRDSRNE--RRSRSPRDS 186 >09_02_0104 - 4329068-4329926,4330967-4331811 Length = 567 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 16 MKEHVFFAGIDWQQVYHQKYTPPLIPPRGRSTPPMPSTLEASTKKTPK 159 +K+H FF G++W + + TPP IP + ST + +T K Sbjct: 511 IKQHPFFEGVNWALI--RCATPPDIPKPVEIPRSVASTSQKATTTAEK 556 >06_03_1482 + 30441670-30441758,30441848-30441959 Length = 66 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 494 PPRQCPAESFRAWRCSRGAARAGSGTVWRNEFATH*RRGR 375 PPR P+++ R R +A GSG N+F + RR R Sbjct: 20 PPRVAPSDTTRIDTTQRVSAIDGSGAGCHNQFGGNQRRKR 59 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 76 TPPLIPPRGRSTPPM-PSTLEASTKKTP 156 +PP +PP + PP+ P+TL S+ TP Sbjct: 64 SPPPLPPLQPTPPPLPPTTLSCSSHPTP 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,749,347 Number of Sequences: 37544 Number of extensions: 410395 Number of successful extensions: 1821 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1810 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -