BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20724 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 25 3.3 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 3.3 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 23 7.7 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 7.7 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 23 7.7 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 24.6 bits (51), Expect = 3.3 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -1 Query: 264 RQLKIFTLLAGESSNKSAAGS*SPTLIGAMLNCEM*SARADAR 136 R L + G SSN S SP IG+M+ + +A D R Sbjct: 59 RTLGVMAGRGGSSSNSSKTELFSPVSIGSMMLLLLRAANRDTR 101 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +1 Query: 259 LTAGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKLKSDGVAE 384 +T GK + LFA+ G C + Y+Q + +D + E Sbjct: 173 ITWGKVISLFAIAGGLAVDCVRQDHADYLQQLIEGTADVIEE 214 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 477 GIG*HTHLSFGVVLSSPSRHHIRVINRHAHYFSN 376 G G TH FG VL+ S + R+ R+ + +N Sbjct: 128 GSGGSTHEEFGKVLTPSSMNWKRMHQRYGNVLAN 161 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 7.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 609 QCHRAPHSDLGPCC 568 QCH+A H D+G C Sbjct: 341 QCHKALHLDIGLRC 354 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 466 LADPSGNFIKALDLAPICRRSEVSAPKGSR 555 LA SGN+ + P +R+ V P G++ Sbjct: 126 LARTSGNYASVIAHNPDTKRTRVKLPSGAK 155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 804,404 Number of Sequences: 2352 Number of extensions: 17015 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -