BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20724 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 26 0.33 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 3.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 3.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 3.1 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 3.1 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 7.1 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 21 9.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 9.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 9.4 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 9.4 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 9.4 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 26.2 bits (55), Expect = 0.33 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 20 YDRYNKINNK*GNYHSKNFYLLMFL 94 Y YN NN NY+ K +Y + ++ Sbjct: 91 YSNYNNYNNNYNNYNKKLYYNINYI 115 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 20 YDRYNKINNK*GNYHSKNFYLLMFL 94 Y+ YN NN N + K +Y + ++ Sbjct: 334 YNNYNNYNNNYNNNYKKLYYNINYI 358 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 20 YDRYNKINNK*GNYHSKN 73 Y YN NN NY++ N Sbjct: 324 YSNYNNYNNNYNNYNNYN 341 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 428 QAAITYGSLTDTHTISATPSDFSLSAF 348 Q AITY D T+ +PS SL+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 428 QAAITYGSLTDTHTISATPSDFSLSAF 348 Q AITY D T+ +PS SL+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 428 QAAITYGSLTDTHTISATPSDFSLSAF 348 Q AITY D T+ +PS SL+A+ Sbjct: 262 QTAITYVWKNDEGTLRKSPSLTSLNAY 288 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 428 QAAITYGSLTDTHTISATPSDFSLSAF 348 Q AITY D T+ +PS SL+A+ Sbjct: 211 QTAITYVWKNDEGTLRKSPSLTSLNAY 237 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 5 YHLLTYDRYNKINNK*GNYHSKNFY 79 Y Y+ YN NN N ++K Y Sbjct: 322 YKYSNYNNYNNYNNNNYNNYNKKLY 346 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -2 Query: 365 FSLSAFCTYPGKCVLEHPGVKAPGTANNTTFFP 267 + S T+ G C+ PG+ + T+FP Sbjct: 87 YQTSVVVTHDGSCLYVPPGIFKSTCKIDITWFP 119 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -2 Query: 365 FSLSAFCTYPGKCVLEHPGVKAPGTANNTTFFP 267 + S T+ G C+ PG+ + T+FP Sbjct: 87 YQTSVVVTHNGSCLYVPPGIFKSTCKIDITWFP 119 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 20 YDRYNKINNK*GNYHSKNF 76 Y YN NN N ++ N+ Sbjct: 91 YSNYNNYNNNYNNNYNNNY 109 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 20 YDRYNKINNK*GNYHSKNF 76 Y YN NN N ++ N+ Sbjct: 91 YSNYNNYNNNYNNNYNNNY 109 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +2 Query: 5 YHLLTYDRYNKINNK*GNYHSKNFYLLMFL 94 Y Y+ YN N NY +Y + ++ Sbjct: 89 YKYSNYNNYNNNNYNNNNYKKLQYYNINYI 118 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +2 Query: 5 YHLLTYDRYNKINNK*GNYHSKNFYLLMFL 94 Y Y+ YN N NY +Y + ++ Sbjct: 89 YKYSNYNNYNNNNYNNNNYKKLQYYNINYI 118 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +2 Query: 5 YHLLTYDRYNKINNK*GNYHSKNFYLLMFL 94 Y Y+ YN N NY +Y + ++ Sbjct: 89 YKYSNYNNYNNNNYNNNNYKKLQYYNINYI 118 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +2 Query: 5 YHLLTYDRYNKINNK*GNYHSKNFYLLMFL 94 Y Y+ YN N NY +Y + ++ Sbjct: 89 YKYSNYNNYNNNNYNNNNYKKLQYYNINYI 118 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,144 Number of Sequences: 438 Number of extensions: 4684 Number of successful extensions: 23 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -