BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20723 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62860.1 68414.m07098 pentatricopeptide (PPR) repeat-containi... 33 0.26 At3g61390.2 68416.m06872 U-box domain-containing protein several... 31 0.61 At2g30780.1 68415.m03753 pentatricopeptide (PPR) repeat-containi... 31 0.61 At5g65910.1 68418.m08296 BSD domain-containing protein contains ... 31 0.81 At1g66170.1 68414.m07511 PHD finger family protein (MMD1) contai... 31 0.81 At1g51070.1 68414.m05741 basic helix-loop-helix (bHLH) family pr... 30 1.9 At5g60800.1 68418.m07628 heavy-metal-associated domain-containin... 29 3.3 At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p... 29 3.3 At1g12380.1 68414.m01431 expressed protein 29 3.3 At5g29624.1 68418.m03640 DC1 domain-containing protein contains ... 29 4.3 At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family pr... 29 4.3 At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) ide... 29 4.3 At1g03830.1 68414.m00364 guanylate-binding family protein contai... 29 4.3 At2g40435.1 68415.m04988 expressed protein 28 7.5 At5g54050.1 68418.m06722 DC1 domain-containing protein 27 9.9 At5g48310.1 68418.m05968 expressed protein 27 9.9 At4g03430.1 68417.m00470 pre-mRNA splicing factor-related simila... 27 9.9 At3g15920.1 68416.m02013 phox (PX) domain-containing protein wea... 27 9.9 At3g14490.1 68416.m01835 terpene synthase/cyclase family protein... 27 9.9 At1g64320.1 68414.m07289 myosin heavy chain-related similar to m... 27 9.9 At1g34480.1 68414.m04285 DC1 domain-containing protein contains ... 27 9.9 At1g11670.1 68414.m01340 MATE efflux family protein similar to r... 27 9.9 >At1g62860.1 68414.m07098 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 534 Score = 32.7 bits (71), Expect = 0.26 Identities = 24/78 (30%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = -2 Query: 277 FIRHFNVFKSLFNDGLISSTITLTGMSMTSFLFARRLLSMSLMVLAWSMSSCSLD--KLS 104 F+R +++ + G+I ST+T M + F RL MV + CS D S Sbjct: 372 FLRAEDIYLEMLCKGIIPSTVTYNSM-VDGFCKQNRLEEARQMVDSMVSEGCSPDVVTFS 430 Query: 103 TTFKGLSSASGTLSGMEL 50 T KG A G+EL Sbjct: 431 TLIKGYCKAGRVDDGLEL 448 >At3g61390.2 68416.m06872 U-box domain-containing protein several hypothetical proteins - Arabidopsis thaliana Length = 435 Score = 31.5 bits (68), Expect = 0.61 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +2 Query: 266 VPDENEEIKRPLVDLRN-PGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGF 442 + +E EE+K L ++ G + +E T N H E + + + +DI GF Sbjct: 319 IREEQEELKIKLREVSKLKGKREEEEASTSN--HREPPQYFICPITHDIMEDPHVAADGF 376 Query: 443 QEVSDGIGKWYARTEQINEL 502 + I +W+ R + + + Sbjct: 377 TYEGEAISRWFERGHETSPM 396 >At2g30780.1 68415.m03753 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 452 Score = 31.5 bits (68), Expect = 0.61 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +2 Query: 347 TQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 484 T P HH D + VS +K+++ T + ++ FQ V D G+W RT Sbjct: 20 TSLPAHHTDLVQRVSILKDELLTIGNS-KEKFQNVLDQKGQWLFRT 64 >At5g65910.1 68418.m08296 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 432 Score = 31.1 bits (67), Expect = 0.81 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +2 Query: 308 LRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGI 463 L P + Q P+H E+ E +++ +KND R G ++S + Sbjct: 64 LSQPSSSPDLQERNQTPDHPEEDEDLIAGIKNDFAEIGGRFRTGISKLSGNL 115 >At1g66170.1 68414.m07511 PHD finger family protein (MMD1) contains Pfam profile: PF00628: PHD-finger Length = 704 Score = 31.1 bits (67), Expect = 0.81 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 504 WSSLICSVRAYHFPIPSDTSW 442 WS+ S R YHF IP DT W Sbjct: 100 WSNHFVSKRKYHFIIPIDTEW 120 >At1g51070.1 68414.m05741 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GI:3757520 from [Arabidopsis thaliana] Length = 226 Score = 29.9 bits (64), Expect = 1.9 Identities = 22/96 (22%), Positives = 48/96 (50%) Frame = +3 Query: 60 PDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPS 239 P + P+ DK + D + + D+A +KD+++SL+ KE+ D K + + K Sbjct: 95 PGRTPKT-DKVAIINDAIRMVNQARDEAQKLKDLNSSLQEKIKELKD--EKNELRDEKQK 151 Query: 240 LKSDLKTLKCRMKMRKSRGL*SI*EIPGPRSIKSTK 347 LK + + + ++K K++ +P P+++ + Sbjct: 152 LKVEKERIDQQLKAIKTQPQPQPCFLPNPQTLSQAQ 187 >At5g60800.1 68418.m07628 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 283 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 260 VEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDIN 412 V++ ++ EE + VDL +P P + +E E +N ++ ED +K K D N Sbjct: 74 VKLREKLEEKTKKKVDLVSPQPKKEKEKENKN-KNDEDKKKSEEKKKPDNN 123 >At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, putative / HSP70, mitochondrial, putative strong similarity to SP|Q01899 Heat shock 70 kDa protein, mitochondrial precursor {Phaseolus vulgaris} Length = 682 Score = 29.1 bits (62), Expect = 3.3 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 2/85 (2%) Frame = +2 Query: 254 KNVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALR 433 K E+ + ++ K+ L+DLRN E E+ EKI + + ++I TA LR Sbjct: 561 KEAELNAQKDQEKKQLIDLRNSADTTIYSVEKSLSEYR---EKIPAEIASEIETAVSDLR 617 Query: 434 QGF--QEVSDGIGKWYARTEQINEL 502 ++V D K A + ++++ Sbjct: 618 TAMAGEDVEDIKAKVEAANKAVSKI 642 >At1g12380.1 68414.m01431 expressed protein Length = 793 Score = 29.1 bits (62), Expect = 3.3 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 1/91 (1%) Frame = +2 Query: 230 QTVVEE*FKNVEVPDENEE-IKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKND 406 + VVE FK P I PL +R+ + +PE +D +K+++ + + Sbjct: 586 EKVVERRFKKSYHPAWAAAFILDPLYLIRDSSGKYLPPFKCLSPEQEKDVDKLITRLVSR 645 Query: 407 INTAEIALRQGFQEVSDGIGKWYARTEQINE 499 + A IAL + + ++G+ YAR Q+ E Sbjct: 646 -DEAHIALMELMKWRTEGLDPMYARAVQMKE 675 >At5g29624.1 68418.m03640 DC1 domain-containing protein contains Pfam PF03107: DC1 domain Length = 488 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 263 EVPDENEEIKRPLVDLRNPGPPQHQEHE 346 +VPDE EEIK P + G H HE Sbjct: 264 DVPDEEEEIKDPFKVINENGDIVHISHE 291 >At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 284 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = +3 Query: 84 DKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPSLKSDLKTL 263 DK + D + +EL + N +K +L +E+ K + E K SLKSD++ L Sbjct: 40 DKATILTDTVQLLKELTSEVNKLKSEYTALTDESRELTQ--EKNDLREEKTSLKSDIENL 97 Query: 264 KCRMKMR 284 + + R Sbjct: 98 NLQYQQR 104 >At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) identical to cDNA tubulin folding cofactor A, GI:20514256, SP|O04350 Tubulin-specific chaperone A (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin cofactor A homolog) {Arabidopsis thaliana} Length = 113 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +2 Query: 266 VPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 421 +PD ++ ++ L DL++ + E + PE EDA+K V+ V+ T + Sbjct: 62 IPDCHKRLESALADLKSTLAELEETDEKEGPE-IEDAKKTVADVEKQFPTED 112 >At1g03830.1 68414.m00364 guanylate-binding family protein contains Pfam domains PF02263: Guanylate-binding protein, N-terminal domain and PF02841: Guanylate-binding protein, C-terminal domain Length = 991 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/64 (26%), Positives = 33/64 (51%) Frame = +3 Query: 99 VVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPSLKSDLKTLKCRMK 278 V + +++ +E + QA+T +D LRA V+D K+I E+ + + R + Sbjct: 536 VTEKIAAMEEKLKQASTTED---GLRAEFSRVLDEKEKIITEKAAKLATLEQQLASTRAE 592 Query: 279 MRKS 290 ++KS Sbjct: 593 LKKS 596 >At2g40435.1 68415.m04988 expressed protein Length = 158 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/66 (28%), Positives = 27/66 (40%) Frame = +1 Query: 544 IQKLNETLHFIKPADTIAAPSVEETQNKASFETIESGLKSLETNFNSGLNQLSEGIQIVA 723 IQKL + + T S E T K T+E+ K N SG NQ + ++ Sbjct: 40 IQKLKQKVERFNQDPTAEQSSSEPTDPKTPMVTVETLDKGFMINVFSGKNQPGMLVSVLE 99 Query: 724 TFKADG 741 F+ G Sbjct: 100 AFEDIG 105 >At5g54050.1 68418.m06722 DC1 domain-containing protein Length = 580 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 263 EVPDENEEIKRPLVDLRNPGPPQHQEHE 346 +VP+E EEIK P + G H HE Sbjct: 276 DVPEEEEEIKDPFKVINEKGDIVHFSHE 303 >At5g48310.1 68418.m05968 expressed protein Length = 1156 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 640 TIESGLKSLETNFNSGLNQLSEGIQIVAT 726 T+ KSL+ NF SGL +S +Q+ AT Sbjct: 636 TVFENYKSLDENFPSGLADISCPVQVSAT 664 >At4g03430.1 68417.m00470 pre-mRNA splicing factor-related similar to pre-mRNA splicing factor pre-mRNA splicing factor prp1 (SP:Q12381) [Fission yeast] Length = 1029 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 389 SSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQINELQA 508 + +++D+ LR+G + + D + W A E NE A Sbjct: 458 AKLEHDVENKSRVLRKGLEHIPDSVRLWKAVVELANEEDA 497 >At3g15920.1 68416.m02013 phox (PX) domain-containing protein weak similarity to myosin heavy chain [Rana catesbeiana] GI:4249699; contains Pfam profile PF00787: PX domain Length = 755 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +2 Query: 257 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQ 436 N + EN+ + + + D+R H+EHE + + + +V VK+ + T + LRQ Sbjct: 526 NESLVQENQMLLQQINDIRENFENFHKEHEELEVKAKAELKVLVKEVKS-LRTTQSDLRQ 584 >At3g14490.1 68416.m01835 terpene synthase/cyclase family protein contains Pfam profile: PF01397 terpene synthase family Length = 601 Score = 27.5 bits (58), Expect = 9.9 Identities = 20/62 (32%), Positives = 35/62 (56%) Frame = +2 Query: 386 VSSVKNDINTAEIALRQGFQEVSDGIGKWYARTEQINELQAACNISKKISALRYKS*MKR 565 V +KNDINT E + +G EV+ G+ Y + +++ +A ++ KI + YK M+ Sbjct: 492 VFRIKNDINTFEQEMSRG--EVAKGL-NCYMKQHGVSKEEAIGEMN-KIYSNYYKIIMEE 547 Query: 566 YI 571 Y+ Sbjct: 548 YL 549 >At1g64320.1 68414.m07289 myosin heavy chain-related similar to myosin heavy chain (GI:4249703) [Rana catesbeiana]; similar to smooth muscle myosin heavy chain SM2 (GI:2352945) [Homo sapiens] Length = 476 Score = 27.5 bits (58), Expect = 9.9 Identities = 30/118 (25%), Positives = 56/118 (47%) Frame = +3 Query: 129 LIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPSLKSDLKTLKCRMKMRKSRGL*SI 308 L+DQ N +K SLR+ K E + ++ VEE+ + K LK+LK + ++R I Sbjct: 94 LMDQVNGMKHELESLRSQKDE-SEAKLEKKVEEVTET-KMQLKSLKEETEEERNRLSEEI 151 Query: 309 *EIPGPRSIKSTKHRILNTTKMLKKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLV 482 ++ G + + L++ M K+ +M +K L + S + + V E ++ Sbjct: 152 DQLKGENQMLHRRISELDSLHMEMKTKSAHEMEDASKK-LDTEVSDQKKLVKEQDDII 208 >At1g34480.1 68414.m04285 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 602 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 675 ICL*RLETRFDCFKRSFILRF 613 IC R +TRFDC K F+L F Sbjct: 445 ICKVRSQTRFDCGKCDFVLCF 465 >At1g11670.1 68414.m01340 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family; EST gb|W43487 comes from this gene Length = 503 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = -2 Query: 205 GMSMTSFLFARRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSG 59 GMSM + +FA RL SM L + S ++ L G+ SA TL G Sbjct: 70 GMSMLTRIFAGRLGSMQLAAASLGNSGFNMFTLGLML-GMGSAVETLCG 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,935,868 Number of Sequences: 28952 Number of extensions: 269370 Number of successful extensions: 1110 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -