BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20720 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical pro... 24 1.1 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 4.5 >AM712903-1|CAN84642.1| 148|Tribolium castaneum hypothetical protein protein. Length = 148 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 41 SGSCARRGSPPQTGRRRVGSGPELGLDLKKSTQFLRK 151 S S R+ + G ++G E+G DLK +F+R+ Sbjct: 63 SNSPLRKARYTEKGTCKMGREIEVGYDLKSPDRFVRQ 99 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 123 KSSPNSGPEPTLLRPV*GGEPLLA 52 K++P PEP + + G PLLA Sbjct: 347 KNTPYHTPEPDCIHELLGHMPLLA 370 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 206 KRSPQSPKSAQCTPSH 253 + P+SP+S+ TP H Sbjct: 418 QNQPESPESSSSTPRH 433 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,595 Number of Sequences: 336 Number of extensions: 3687 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -