BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20720 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 31 0.13 SPAPB17E12.14c |||6-phosphofructo-2-kinase |Schizosaccharomyces ... 25 8.6 >SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 419 Score = 31.5 bits (68), Expect = 0.13 Identities = 24/61 (39%), Positives = 29/61 (47%) Frame = +2 Query: 65 SPPQTGRRRVGSGPELGLDLKKSTQFLRKCPTSPVLPSQYDEEDRFCKRSPQSPKSAQCT 244 SP QT RR V GP G++ K++T R S SQY + F S QSP S Sbjct: 209 SPKQT-RRVVSEGPLNGVNYKQNTTNNR---VSSFQNSQYSTLNNFQNNSNQSPNSNDLQ 264 Query: 245 P 247 P Sbjct: 265 P 265 >SPAPB17E12.14c |||6-phosphofructo-2-kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 25.4 bits (53), Expect = 8.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 450 VGQFPR*RHQHDLHGHRHLLDFDPATKQARKIQGRLRM 563 VG F R +H H H FDP+ ++A K++ M Sbjct: 32 VGNF---RRKHASHSHDDASFFDPSNEEASKLRESFAM 66 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,114,753 Number of Sequences: 5004 Number of extensions: 66204 Number of successful extensions: 194 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 194 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -