BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20715 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.15c |||sphingosine hydroxylase |Schizosaccharomyces pomb... 27 2.6 SPAC57A10.07 |||conserved protein |Schizosaccharomyces pombe|chr... 26 5.9 SPAC1B1.01 |||transcription factor Rdp1|Schizosaccharomyces pomb... 26 5.9 >SPBC887.15c |||sphingosine hydroxylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 27.1 bits (57), Expect = 2.6 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +2 Query: 365 PSASLEVATPPQIYSRIWFLVTRWERIWLRFLHF 466 P + P Y +F++ W+ W R+LH+ Sbjct: 121 PKLAYNFIVPAFQYFFAFFIIDSWQYFWHRYLHY 154 >SPAC57A10.07 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 311 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 577 LPRFSIQTQN*SETYWHVTSQRERTRSSIVAIRVGTCI 690 LP ++ QT + S +W V S + RT ++ A + CI Sbjct: 10 LPFYATQTAS-SSRFWRVLSPKSRTGIALYASLILLCI 46 >SPAC1B1.01 |||transcription factor Rdp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 478 Score = 25.8 bits (54), Expect = 5.9 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 Query: 505 RPWRWASELNSTFEMKKPEPYSFPPRNEKPNAGVDLRGRSNLKTRTRR 362 RP +AS +P + PP K + DLR S+ + R RR Sbjct: 196 RPVNFASHAKQCPSFLAMDPNNIPPEINKVSPHDDLRPLSDSRRRARR 243 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,738,916 Number of Sequences: 5004 Number of extensions: 53430 Number of successful extensions: 126 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -