BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20712 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 136 6e-34 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 6.3 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 6.3 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 6.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 6.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.4 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 136 bits (328), Expect = 6e-34 Identities = 65/75 (86%), Positives = 70/75 (93%) Frame = +2 Query: 20 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAXAYGLDKKGTGERNVLIFDL 199 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 200 GGGTFDVSILTIEDG 244 GGGTFDVSILTI++G Sbjct: 61 GGGTFDVSILTIDEG 75 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 10 NCAECSYHGSRVLQ*LSKTSHKR-CRY 87 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 10 NCAECSYHGSRVLQ*LSKTSHKR-CRY 87 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 10 NCAECSYHGSRVLQ*LSKTSHKR-CRY 87 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 10 NCAECSYHGSRVLQ*LSKTSHKR-CRY 87 NCA C HG ++ HKR C+Y Sbjct: 40 NCARCRNHGLKI----GLKGHKRYCKY 62 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 318 LCPGVQEEIQKGPRYQQES 374 L PG+QE I + R QQE+ Sbjct: 2077 LSPGLQEVIDRFVRIQQEN 2095 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 563,874 Number of Sequences: 2352 Number of extensions: 11030 Number of successful extensions: 31 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -