BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20711 (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 27 0.087 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.3 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 5.7 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 27.5 bits (58), Expect = 0.087 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 465 LCTSLASTSDLAK*CVCCRCVGDNAGLYSSGEPGDTGPLFDIEANLC 325 +CT D + V CV D + L S + G ++D+E N+C Sbjct: 442 VCTKEGIVRDPSDCSVYYTCVSDGSKLVSIQRKCNHGLVYDLELNIC 488 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 404 LATTLDCTRAESRETPDRCSI 342 L TTL CT+A PD CSI Sbjct: 417 LTTTL-CTKAGYVRDPDDCSI 436 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 4.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 545 LGRRVLVVEADLVSSWSSPLAATRG 471 L RR + L WSS ATRG Sbjct: 531 LARRERQLHMQLYPDWSSRANATRG 555 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 4.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 545 LGRRVLVVEADLVSSWSSPLAATRG 471 L RR + L WSS ATRG Sbjct: 423 LARRERQLHMQLYPDWSSRANATRG 447 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = -1 Query: 179 REILSDQSAHAQLL--PAHEGLP 117 RE LS SAH L+ P H +P Sbjct: 52 RESLSPSSAHTVLIPQPLHPSVP 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,898 Number of Sequences: 336 Number of extensions: 2560 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -