BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20711 (578 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24870.1 68416.m03119 expressed protein 33 0.10 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 33 0.14 At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101)... 30 0.97 At5g67300.1 68418.m08486 myb family transcription factor contain... 29 2.2 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 29 2.2 At2g16900.1 68415.m01946 expressed protein 29 2.2 At2g42490.1 68415.m05256 copper amine oxidase, putative similar ... 28 3.9 At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 28 5.2 At4g16670.1 68417.m02518 expressed protein 28 5.2 At3g42070.1 68416.m04317 hypothetical protein 28 5.2 At2g43340.1 68415.m05389 expressed protein 28 5.2 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 27 6.8 At2g40040.1 68415.m04920 defective chloroplasts and leaves prote... 27 6.8 At4g38550.1 68417.m05458 expressed protein 27 9.0 >At3g24870.1 68416.m03119 expressed protein Length = 1841 Score = 33.5 bits (73), Expect = 0.10 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +2 Query: 260 GSSQPSTPNKSHSYNDYMISLQHKLASISNSGPVSPGSPLEYSPALSPTHRQH--THHLA 433 G+ PS + ++D I Q A+ N + S L +PA++P++ QH H Sbjct: 1611 GALSPSPQQQMQLHSDNSIQGQSSPATPCN---ILSTSSLSIAPAVAPSNHQHLLIHQKQ 1667 Query: 434 KSDVEASEVHKSRHVSQLADWTTSSQDQPPLQARAAQGRVHTTQ 565 ++ V+++ +H + L + S + Q R Q +TTQ Sbjct: 1668 RNQVQSTAQRVVQH-NHLGNSELSKKSQAECMPRVPQSVTNTTQ 1710 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 33.1 bits (72), Expect = 0.14 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Frame = +2 Query: 254 PTGSSQPSTPNKSHSYNDYMISL------QHKLASISNSGPVSPGSPLEYSPALSPTH 409 P S P+ P KSHS + Q +S+S + P SP+ ++PALSP+H Sbjct: 141 PVPSVSPTQPPKSHSPVSPVAPASAPSKSQPPRSSVSPAQPPKSSSPISHTPALSPSH 198 >At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101) family protein contains Pfam profile PF05743: Tumour susceptibility gene 101 protein (TSG101); similar to Tumor susceptibility gene 101 protein (Swiss-Prot:Q99816) [Homo sapiens] Length = 398 Score = 30.3 bits (65), Expect = 0.97 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 365 PGSPLEYSPALSPTHRQHTHHLAKSDVEASEVHKSRHVSQLADWTTS 505 P P Y +S QH HH +SD +A+EV K ++++ + S Sbjct: 192 PFPPSPYGGGVSRVQVQHVHHQQQSD-DAAEVFKRNAINKMVEMVHS 237 >At5g67300.1 68418.m08486 myb family transcription factor contains PFAM profile: myb DNA binding domain PF00249 Length = 305 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 5 SPASEHRPGPQLGAQPESNGAESYAQFGFSWAEL 106 SP EHRP A+ + A ++AQFG WA + Sbjct: 53 SPQVEHRP---FSAEEDETIARAHAQFGNKWATI 83 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 395 LSPTHRQHTHHLAKSDVEASEVHKSRHV 478 LS H++H + LA+ E ++ KSRHV Sbjct: 487 LSSRHKRHENKLAEKAPEEPKIEKSRHV 514 >At2g16900.1 68415.m01946 expressed protein Length = 382 Score = 29.1 bits (62), Expect = 2.2 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +2 Query: 317 SLQHKLASISNSGPVSPGSPLEYSPALSPTHRQHTHHLAKSDVEASEV 460 S HK S + P+SP S + LSP + H H K+D ASE+ Sbjct: 120 SFNHKQEKPSRTVPLSPNSMADRGKPLSPRPQGH-EHSGKNDT-ASEI 165 >At2g42490.1 68415.m05256 copper amine oxidase, putative similar to copper methylamine oxidase precursor (MAOXII) [Arthrobacter sp.] SWISS-PROT:Q07123 Length = 776 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 293 HSYNDYMISLQHKLASISNSGPVSPGSPLEYSPALSP 403 H Y D I + KL I + G + PG +Y ++P Sbjct: 503 HFYQDGKIEAEVKLTGILSLGALQPGETRKYGTTIAP 539 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 27.9 bits (59), Expect = 5.2 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 362 SPGSPLEYSPALSPTHRQHTHHLAKSDVEA-SEVHKSRHVSQLA-DWTTSSQDQP 520 S GS L SP+LSP+H + + D A + V K+ V+ LA D S+ +P Sbjct: 68 SEGS-LILSPSLSPSHSKESEFQKTGDASACANVEKANKVNSLATDDVDKSKSKP 121 >At4g16670.1 68417.m02518 expressed protein Length = 429 Score = 27.9 bits (59), Expect = 5.2 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 5/72 (6%) Frame = +2 Query: 356 PVSPGSPLEY---SPALSPTHRQHTHHLAKSDVEASEVHKSRHVSQLADWTTSS--QDQP 520 P +P P+E+ S +LS + KSD +++K+ ++SQLAD T+ + P Sbjct: 58 PKTPREPMEFLCRSWSLSTSEISLALSSQKSD---KQLNKNPNISQLADVTSLAPVAPPP 114 Query: 521 PLQARAAQGRVH 556 PLQ VH Sbjct: 115 PLQTGKLASAVH 126 >At3g42070.1 68416.m04317 hypothetical protein Length = 230 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +2 Query: 266 SQPSTPNKSHSYNDYMI----SLQHKLASISNSGPVSPGSPLEYSPAL 397 S P P + H + Y++ S+ + +A++S G V+P +SPAL Sbjct: 181 SPPPIPMEPHVFQKYVVDSFKSVWNAIATLSRCGCVAPTRRRRHSPAL 228 >At2g43340.1 68415.m05389 expressed protein Length = 189 Score = 27.9 bits (59), Expect = 5.2 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +2 Query: 365 PGSPLEYSPALSPTHRQHTHHLAKSDVEASEVHKSRHVSQLADWTTSSQDQPPLQARA 538 P L YS + + H HH + S + S V S VS +A W SS P +A Sbjct: 116 PALELCYSMSQKFIDQDHHHHSSSSPEKKSSVLDSP-VSPIASWKISSPGDNPDDVKA 172 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 27.5 bits (58), Expect = 6.8 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 10/78 (12%) Frame = +2 Query: 254 PTGSSQPSTP-------NKSHSYNDYMIS--LQHKLASISNSGPVSPGSPLEYSPAL-SP 403 PTG S P+TP NKS + N+ S H S+ S P S S SP L +P Sbjct: 18 PTGKSSPATPRIAKRTVNKSETSNNNSPSTTTPHSRLSLDRSSPNSKSSVERRSPKLPTP 77 Query: 404 THRQHTHHLAKSDVEASE 457 + A E+ + Sbjct: 78 PEKSQARVAAVKGTESPQ 95 >At2g40040.1 68415.m04920 defective chloroplasts and leaves protein-related / DCL protein-related similar to DCL protein, chloroplast precursor (Defective chloroplasts and leaves protein) (Swiss-Prot:Q42463) [Lycopersicon esculentum] Length = 839 Score = 27.5 bits (58), Expect = 6.8 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 2/97 (2%) Frame = +2 Query: 254 PTGSSQPSTPNKSHSYNDYMISLQHKLASISNSGPVSPGSPLEYSPALSPTHRQ-HTHHL 430 P G Q PN+S Q + S S + SP SP+ + + Q + Sbjct: 728 PPGEEQSQPPNQSIGNGGDDFQTQTQSQSPSQTRAQSPSQAQAQSPSQTQSQSQSQSQSQ 787 Query: 431 AKSDVEASEVHKSRHVSQLADWTTS-SQDQPPLQARA 538 ++S ++ +S+ SQ + S +Q Q P Q +A Sbjct: 788 SQSQSQSQSQSQSQSQSQSQSQSPSQTQTQSPSQTQA 824 >At4g38550.1 68417.m05458 expressed protein Length = 612 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +2 Query: 254 PTGSSQPSTPNKSHSYNDYMISLQHKLASISNSGPVSPGSPLEYSPALSPTHRQ 415 P G+ P P KS Y ++ + SN+ P P SP +P R+ Sbjct: 120 PAGNRTPERPRKSTEYRREHQDRMYEADTRSNASPFHPFRSPSPSPFHTPDRRR 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,159,554 Number of Sequences: 28952 Number of extensions: 228043 Number of successful extensions: 751 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -