BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20707 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 1.2 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 3.8 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 3.8 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 3.8 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 364 FNKRLQPLQNFTGQYHYRGGSIANLGILRLCNIHK 260 +NK ++P+QN T + H G L ++L N+++ Sbjct: 38 YNKLIRPVQNMTEKVHVNFG----LAFVQLINVNE 68 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 665 TRYQERVFKSSTGTFLIPIM 606 TR Q V SS G+F IP++ Sbjct: 191 TRRQGYVIYSSLGSFFIPLL 210 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 665 TRYQERVFKSSTGTFLIPIM 606 TR Q V SS G+F IP++ Sbjct: 191 TRRQGYVIYSSLGSFFIPLL 210 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 665 TRYQERVFKSSTGTFLIPIM 606 TR Q V SS G+F IP++ Sbjct: 191 TRRQGYVIYSSLGSFFIPLL 210 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,643 Number of Sequences: 438 Number of extensions: 4128 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -