BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20705 (761 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 8.1 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 8.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.1 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 242 SASLSVQIHYHNLLHSQTSLQWRTNYTLKFTL 337 SAS +VQ H + L S+TSL T + L ++ Sbjct: 15 SASETVQDHRNLLDWSKTSLDNATEHKLPISM 46 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 242 SASLSVQIHYHNLLHSQTSLQWRTNYTLKFTL 337 SAS +VQ H + L S+TSL T + L ++ Sbjct: 15 SASETVQDHRNLLDWSKTSLDNATEHKLPISM 46 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 231 TVALQPAYRSKFIITICSTV 290 T P Y S+ ++T CS+V Sbjct: 89 TSTSNPTYSSRSVMTSCSSV 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,447 Number of Sequences: 336 Number of extensions: 4092 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -