BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20705 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.3 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 3.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 3.1 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 3.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 3.1 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.4 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.4 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.4 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.4 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 7.1 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 9.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.4 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 176 NYRRTTLYVFVTPHNHYYTQNNKVNESFDKL 84 NY+ + + +N+Y NN N ++ KL Sbjct: 321 NYKYSNYNNYNNNYNNYNNYNNNYNNNYKKL 351 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 224 QTHGGPSASLSVQIHYHNLLHSQTSLQWRTNYTL 325 + H S+ + NL+ +SLQW + +TL Sbjct: 469 ELHNSSPFSIYSFLERLNLIFMSSSLQWSSTHTL 502 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 224 QTHGGPSASLSVQIHYHNLLHSQTSLQWRTNYTL 325 + H S+ + NL+ +SLQW + +TL Sbjct: 507 ELHNSSPFSIYSFLERLNLIFMSSSLQWSSTHTL 540 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 661 DESVRIWDVRTGKCLKPLPAHSDPVSAVHFNRD 759 +ESV ++RT CL P P + ++ +R+ Sbjct: 615 EESVHSMELRTLPCLLPRPKSENNFASQELSRE 647 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 661 DESVRIWDVRTGKCLKPLPAHSDPVSAVHFNRD 759 +ESV ++RT CL P P + ++ +R+ Sbjct: 583 EESVHSMELRTLPCLLPRPKSENNFASQELSRE 615 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 722 CAGNGFRHFPVLTSHIRTLSSKLPDTI 642 CAG G R VL+ + +L+S L TI Sbjct: 9 CAGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 722 CAGNGFRHFPVLTSHIRTLSSKLPDTI 642 CAG G R VL+ + +L+S L TI Sbjct: 9 CAGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 722 CAGNGFRHFPVLTSHIRTLSSKLPDTI 642 CAG G R VL+ + +L+S L TI Sbjct: 9 CAGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 5.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 722 CAGNGFRHFPVLTSHIRTLSSKLPDTI 642 CAG G R VL+ + +L+S L TI Sbjct: 9 CAGGGGRLSSVLSLSLTSLASSLIFTI 35 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 7.1 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 244 SQLIGPN-SLSQSAPQSNKSSVANE-LYPQIHSRWSYKGCVIGKIQ 375 S L+ P S + A + + NE LY Q W Y VI ++Q Sbjct: 437 SVLLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQ 482 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 18 NVLLKSTLN*MKKRDCAKY 74 ++L K+TLN + + +C KY Sbjct: 308 HILQKTTLNMLTQVECYKY 326 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 256 GPNSLSQSAPQSNKSSVANELY 321 GP + S Q+ SSV+++LY Sbjct: 401 GPGGVPTSVIQAATSSVSDDLY 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,575 Number of Sequences: 438 Number of extensions: 5082 Number of successful extensions: 16 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -