BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20703 (680 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha... 29 0.62 SPAC1420.01c ||SPAC56E4.08c|DUF1752 family protein|Schizosacchar... 26 5.8 SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosa... 26 5.8 >SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 29.1 bits (62), Expect = 0.62 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 161 KFSFEGSQNSVGVIKKYVICVVFMFA 238 KFS +GS NS G++ +Y+ C F A Sbjct: 251 KFSPDGSCNSQGILDRYITCCQFSAA 276 >SPAC1420.01c ||SPAC56E4.08c|DUF1752 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.8 bits (54), Expect = 5.8 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 93 KQKATSNSNVLHEREEHAES*NDDK-LRNTR 4 +QKA NS VL + + NDDK +RN + Sbjct: 537 RQKAAMNSAVLRRQSSQSSGANDDKEVRNRK 567 >SPAC23G3.08c |ubp7||ubiquitin C-terminal hydrolase Ubp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 875 Score = 25.8 bits (54), Expect = 5.8 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 4/62 (6%) Frame = -3 Query: 615 HFARLPSFCHQCGEAIKSSRLESFGIQFDETTCVIPSSVMVRHAAA----ITDPFSSSHL 448 HF + H G++ K ++ S G++ TC S++ V A + PF SH Sbjct: 185 HFKKEKKSKHSSGKSSKKYKVISPGLKNLGATCFFNSTLQVLCACEALHDVISPFQYSHS 244 Query: 447 SI 442 S+ Sbjct: 245 SV 246 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,572,019 Number of Sequences: 5004 Number of extensions: 47312 Number of successful extensions: 119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -