BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20702 (701 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124538-1|BAC85878.1| 256|Homo sapiens protein ( Homo sapiens ... 32 1.7 BC014009-1|AAH14009.2| 476|Homo sapiens GLTSCR2 protein protein. 30 7.0 BC010095-1|AAH10095.1| 478|Homo sapiens glioma tumor suppressor... 30 7.0 BC007248-1|AAH07248.1| 474|Homo sapiens glioma tumor suppressor... 30 7.0 BC006311-1|AAH06311.1| 478|Homo sapiens glioma tumor suppressor... 30 7.0 BC004229-1|AAH04229.2| 472|Homo sapiens GLTSCR2 protein protein. 30 7.0 AY535000-1|AAS46028.1| 478|Homo sapiens preS1 binding protein p... 30 7.0 AL359336-1|CAB94787.1| 467|Homo sapiens GLTSCR2, glioma tumor ... 30 7.0 AL359335-1|CAB94786.1| 459|Homo sapiens GLTSCR2, glioma tumor ... 30 7.0 AF182076-1|AAF62873.1| 478|Homo sapiens glioma tumor suppressor... 30 7.0 Z82187-1|CAI23588.1| 517|Homo sapiens TBC1 domain family, membe... 30 9.2 Z80896-1|CAI22357.1| 517|Homo sapiens TBC1 domain family, membe... 30 9.2 Z79999-1|CAI23583.1| 517|Homo sapiens TBC1 domain family, membe... 30 9.2 CR456412-1|CAG30298.1| 517|Homo sapiens C22orf4 protein. 30 9.2 BC029897-1|AAH29897.1| 517|Homo sapiens TBC1 domain family, mem... 30 9.2 BC020976-1|AAH20976.2| 517|Homo sapiens TBC1 domain family, mem... 30 9.2 BC001292-1|AAH01292.2| 517|Homo sapiens TBC1 domain family, mem... 30 9.2 AL118516-2|CAI17954.1| 517|Homo sapiens TBC1 domain family, mem... 30 9.2 AL096755-1|CAI21503.1| 517|Homo sapiens TBC1 domain family, mem... 30 9.2 AL023733-1|CAI18761.1| 517|Homo sapiens TBC1 domain family, mem... 30 9.2 >AK124538-1|BAC85878.1| 256|Homo sapiens protein ( Homo sapiens cDNA FLJ42547 fis, clone BRACE3004880. ). Length = 256 Score = 32.3 bits (70), Expect = 1.7 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = -1 Query: 233 LISSTITLTGMSMTSFLFARRLLSMSLMVLAWS---MSSCSLDKLSTTFKGLSSASGTLS 63 L S T++ G+S T+ LFA RL S+++ + S +S+C L +++ + GLSS + + Sbjct: 118 LSSMTLSACGLSSTT-LFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLSSMTPSAC 176 Query: 62 GM 57 G+ Sbjct: 177 GL 178 >BC014009-1|AAH14009.2| 476|Homo sapiens GLTSCR2 protein protein. Length = 476 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 92 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 147 >BC010095-1|AAH10095.1| 478|Homo sapiens glioma tumor suppressor candidate region gene 2 protein. Length = 478 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 94 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149 >BC007248-1|AAH07248.1| 474|Homo sapiens glioma tumor suppressor candidate region gene 2 protein. Length = 474 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 90 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 145 >BC006311-1|AAH06311.1| 478|Homo sapiens glioma tumor suppressor candidate region gene 2 protein. Length = 478 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 94 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149 >BC004229-1|AAH04229.2| 472|Homo sapiens GLTSCR2 protein protein. Length = 472 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 88 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 143 >AY535000-1|AAS46028.1| 478|Homo sapiens preS1 binding protein protein. Length = 478 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 94 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149 >AL359336-1|CAB94787.1| 467|Homo sapiens GLTSCR2, glioma tumor suppressor candidate region protein 2 (AF182076_1) protein. Length = 467 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 83 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 138 >AL359335-1|CAB94786.1| 459|Homo sapiens GLTSCR2, glioma tumor suppressor candidate region protein 2 (AF182076_1) protein. Length = 459 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 75 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 130 >AF182076-1|AAF62873.1| 478|Homo sapiens glioma tumor suppressor candidate region protein 2 protein. Length = 478 Score = 30.3 bits (65), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +1 Query: 379 KKSFLPSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQLATFPRKFRRSD 546 K+ L K T Q+KSL +K + +LEN + VP+ +K RR + Sbjct: 94 KEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKE 149 >Z82187-1|CAI23588.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >Z80896-1|CAI22357.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >Z79999-1|CAI23583.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >CR456412-1|CAG30298.1| 517|Homo sapiens C22orf4 protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >BC029897-1|AAH29897.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >BC020976-1|AAH20976.2| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >BC001292-1|AAH01292.2| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >AL118516-2|CAI17954.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >AL096755-1|CAI21503.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 >AL023733-1|CAI18761.1| 517|Homo sapiens TBC1 domain family, member 22A protein. Length = 517 Score = 29.9 bits (64), Expect = 9.2 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 446 GSVRRYWKMVRSYRAN*RAPGSLQHFQENFGAQIPKLNETLH 571 G+ +++WK R+N + PGS+QH +GAQ P + LH Sbjct: 5 GARKQFWK-----RSNSKLPGSIQHV---YGAQHPPFDPLLH 38 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,558,848 Number of Sequences: 237096 Number of extensions: 1695881 Number of successful extensions: 5027 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 4728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5021 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -