BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20699 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 24 5.4 AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 23 7.1 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 7.1 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 23 7.1 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 23 7.1 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 9.4 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 696 FFQFGPTSGPRPVFVDLNLVG 634 FF P SGPR D +L G Sbjct: 9 FFHIVPVSGPRRTLADCSLGG 29 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 484 VICIESLHYRTPGTNTMSTSCR 549 +I + H R TNT+ST C+ Sbjct: 52 IIHLNDFHARFEETNTVSTRCK 73 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 484 VICIESLHYRTPGTNTMSTSCR 549 +I + H R TNT+ST C+ Sbjct: 50 IIHLNDFHARFEETNTVSTRCK 71 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 484 VICIESLHYRTPGTNTMSTSCR 549 +I + H R TNT+ST C+ Sbjct: 52 IIHLNDFHARFEETNTVSTRCK 73 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 484 VICIESLHYRTPGTNTMSTSCR 549 +I + H R TNT+ST C+ Sbjct: 50 IIHLNDFHARFEETNTVSTRCK 71 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.0 bits (47), Expect = 9.4 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 460 PGYMKENFVICIESLHYRTPGTNTMSTSCRLRN*RPASGPHRHCERPPPVGRL 618 PG+MK + + ES + TP + TM R +SG R +P P G++ Sbjct: 210 PGHMKRDCPM--ESNN--TPTSTTMRDYSRKNENCSSSGGQRESLKPKPKGKV 258 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,905 Number of Sequences: 2352 Number of extensions: 16923 Number of successful extensions: 26 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -