BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20698 (712 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 47 2e-07 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 0.46 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 24 1.4 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 3.2 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 23 3.2 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 3.2 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 5.7 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.5 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 9.9 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 46.8 bits (106), Expect = 2e-07 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 4/64 (6%) Frame = +3 Query: 522 SQTGSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHT 689 +QTGSGKT A++LP I ++ + PP + P+ ++++PTRELA QI F + Sbjct: 202 AQTGSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKFAYN 261 Query: 690 SYVR 701 S V+ Sbjct: 262 STVK 265 Score = 40.7 bits (91), Expect = 1e-05 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +2 Query: 353 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 508 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +SG+ Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGR 196 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 25.4 bits (53), Expect = 0.46 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 154 DELSPEFVPPPKFEPTVSTAIIP 86 DE+ PE VP P+ +PT +T P Sbjct: 389 DEIPPEPVPTPEPQPTQTTESEP 411 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 7 VDPASERIHSLNKHLQLNPKN 69 VDP SER+ + L++NP N Sbjct: 511 VDPDSERMAFWQRILKINPNN 531 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 7 VDPASERIHSLNKHLQLNPKN 69 VDP S+R+ + L++NP N Sbjct: 511 VDPDSDRMAFWQRILKINPNN 531 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 7 VDPASERIHSLNKHLQLNPKN 69 VDP S+R+ + L++NP N Sbjct: 511 VDPDSDRMAFWQRILKINPNN 531 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 588 VGYLCAQWLARCRPTFCRN 532 +GY+C + CRP C N Sbjct: 253 LGYICEINVDDCRPGACHN 271 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +1 Query: 226 GRTCDAQIGICFTPTFQQKLL*STSYSSQKIT 321 GR C++++ C T Q + +T ++ K T Sbjct: 332 GRHCESKVNFCATSPCQNGGVCTTIHAGHKCT 363 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 157 GLATVAIDLEDLEALVGKKNSLEGRTCDA 243 G+ +I+ +DL A G KN+L DA Sbjct: 345 GVMIWSIETDDLHATCGTKNALLHAVNDA 373 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 7.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 112 PTVSTAIIPITRHDYFSDLVEDVYLNYGFFLT 17 P T IP DY DLV + +N+ +T Sbjct: 211 PFRKTTEIPPEPEDYVEDLVGHIEVNHSAPIT 242 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 97 AIIPITRHDYFSDLVEDVYL 38 A++P+ +H LV VYL Sbjct: 18 ALLPVKKHHRLEKLVPCVYL 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,796 Number of Sequences: 336 Number of extensions: 4120 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -