BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20698 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 51 9e-09 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.7 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 51.2 bits (117), Expect = 9e-09 Identities = 23/52 (44%), Positives = 31/52 (59%) Frame = +2 Query: 353 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 508 +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G+ Sbjct: 183 QVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGR 234 Score = 31.1 bits (67), Expect = 0.011 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = +3 Query: 522 SQTGSGKTLAYILPAIVHINNQP----PIRRGDGPIALVLAPTRELAQQIQQVAADFGHT 689 +QTGSGKT A+ +P I + + P ++++PTREL QI Q F Sbjct: 240 AQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLN 299 Query: 690 SYVR 701 S ++ Sbjct: 300 SILK 303 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 251 PIWASHVLPSREFFFP 204 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 251 PIWASHVLPSREFFFP 204 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +2 Query: 311 KRSPYEVEEYRNKHEVTV 364 K P++V+++R+K VT+ Sbjct: 64 KNYPFDVDQWRDKTFVTI 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,915 Number of Sequences: 438 Number of extensions: 4688 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -