BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20691 (459 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Sch... 97 2e-21 SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosac... 94 8e-21 SPBC21.02 |||TLDc domain protein 2|Schizosaccharomyces pombe|chr... 29 0.45 SPBC6B1.10 |prp17||splicing factor Prp17|Schizosaccharomyces pom... 27 1.0 SPAC1250.04c |atl1||alkyltransferase-like protein Atl1|Schizosac... 27 1.4 SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 26 3.2 SPAC139.03 |||transcription factor, zf-fungal binuclear cluster ... 25 5.6 SPBC336.10c |tif512||translation initiation factor|Schizosacchar... 25 5.6 SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces p... 25 5.6 SPAC26H5.10c |tif51||translation initiation factor eIF5A|Schizos... 25 5.6 SPAC15A10.15 |sgo2||shugoshin Sgo2|Schizosaccharomyces pombe|chr... 25 7.3 SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosacchar... 25 7.3 SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||... 25 7.3 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 24 9.7 SPAC1F7.10 |||hydantoin racemase family |Schizosaccharomyces pom... 24 9.7 >SPAC3H5.10 |rpl3202|rpl32-2, rpl32|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 96.7 bits (230), Expect = 2e-21 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +2 Query: 65 IVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLP 244 I+KKRTK F RHQSDR+ ++ +WRKPRGID+ VRRRF+G MP IGYG+NKKTR+ +P Sbjct: 6 IIKKRTKPFKRHQSDRFKRVGESWRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMP 65 Query: 245 NG 250 NG Sbjct: 66 NG 67 Score = 68.9 bits (161), Expect = 3e-13 Identities = 32/63 (50%), Positives = 46/63 (73%) Frame = +1 Query: 241 PKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 420 P + LV NV ++E+L+M N+ Y AEIA VS++KR IVE+A+ L ++VTNA A++R Sbjct: 65 PNGLKAFLVRNVSDVELLLMHNKTYAAEIAGNVSARKRVEIVEKARALGVKVTNAGAKVR 124 Query: 421 SQE 429 SQE Sbjct: 125 SQE 127 >SPBC16C6.11 |rpl3201|rpl32-1|60S ribosomal protein L32|Schizosaccharomyces pombe|chr 2|||Manual Length = 127 Score = 94.3 bits (224), Expect = 8e-21 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = +2 Query: 65 IVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLP 244 IVKKRTK F RHQSD + ++ +WRKPRGID+ VRRRF+G MP IGYG+NKKTR+ +P Sbjct: 6 IVKKRTKPFKRHQSDLFKRVGESWRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMP 65 Query: 245 NG 250 NG Sbjct: 66 NG 67 Score = 69.3 bits (162), Expect = 3e-13 Identities = 32/63 (50%), Positives = 46/63 (73%) Frame = +1 Query: 241 PKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 420 P + LV NV ++E+L+M N+ Y AEIA VS++KR IVE+A+ L ++VTNA A++R Sbjct: 65 PNGLKAFLVRNVSDVELLLMHNKTYAAEIASNVSARKRVEIVEKARALGVKVTNAGAKVR 124 Query: 421 SQE 429 SQE Sbjct: 125 SQE 127 >SPBC21.02 |||TLDc domain protein 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 28.7 bits (61), Expect = 0.45 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -1 Query: 432 ILLGAEASGRIRHSDAELLGSFHDQLPLLRRDTMSDLCAVL 310 +L ++ R+ HSD + + +F DQ +RR + LC +L Sbjct: 139 VLKNSKQISRLIHSDVQNISNFFDQNFGIRRSNIYQLCLLL 179 >SPBC6B1.10 |prp17||splicing factor Prp17|Schizosaccharomyces pombe|chr 2|||Manual Length = 558 Score = 27.5 bits (58), Expect = 1.0 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 139 TPIPLKFV--IAIRLMPDKSLRP 77 TP+P+KFV IA+ MP +LRP Sbjct: 427 TPVPIKFVADIAMHSMPRVALRP 449 >SPAC1250.04c |atl1||alkyltransferase-like protein Atl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 108 Score = 27.1 bits (57), Expect = 1.4 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 13 VSKRNIQDGYKTCLQADNRQKEDEEIYQASIG 108 +SKR+I G + Q D ++E EIYQ S+G Sbjct: 66 ISKRDISAGEQR--QKDRLEEEGVEIYQTSLG 95 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 25.8 bits (54), Expect = 3.2 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 247 WIPKVLVHNVKEL-EILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLRS 423 W+ +VL + E+ EI +Q A + G +SKK ++ E ++LSI T ++ Sbjct: 579 WMARVLGDDKAEISEISKVQTSIKSATMIKGSTSKKVAVVSENNRRLSIFDTRSSEFSEK 638 Query: 424 QE 429 +E Sbjct: 639 EE 640 >SPAC139.03 |||transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.0 bits (52), Expect = 5.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 349 SSKRHHERSLRSTSCFASSRFPAL*H 272 +S HER +R + S+RFP L H Sbjct: 446 TSNTMHERHIRLLVSYLSNRFPILLH 471 >SPBC336.10c |tif512||translation initiation factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.0 bits (52), Expect = 5.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 25 NIQDGYKTCLQADNRQKEDEEIYQASIGS 111 NI DGY + D K+D + + +G+ Sbjct: 95 NIDDGYLNLMTTDGTTKDDVRLPEGELGN 123 >SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1098 Score = 25.0 bits (52), Expect = 5.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 89 FIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYG 214 F H D YD+L NW++ ++ +RFK NI G Sbjct: 822 FCVHTRDVYDELVPNWKETYQMEITNVKRFKLIIYQRNIHTG 863 >SPAC26H5.10c |tif51||translation initiation factor eIF5A|Schizosaccharomyces pombe|chr 1|||Manual Length = 157 Score = 25.0 bits (52), Expect = 5.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 25 NIQDGYKTCLQADNRQKEDEEIYQASIGS 111 NI DGY + D K+D + + +G+ Sbjct: 95 NIDDGYLNLMTTDGTTKDDVRLPEGELGN 123 >SPAC15A10.15 |sgo2||shugoshin Sgo2|Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 24.6 bits (51), Expect = 7.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 56 RPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNI 205 R T VK+R K I+ S+ + KP G R R+ K Y +P + Sbjct: 540 RETKVKRRRKARIQETSEESTVVNEPNEKPDGRSRRERK--KVNYALPGL 587 >SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 24.6 bits (51), Expect = 7.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 456 LIIQLYLFILLGAEASGRI 400 LIIQL+ F L+G E G++ Sbjct: 921 LIIQLFTFYLIGFEEEGKM 939 >SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 948 Score = 24.6 bits (51), Expect = 7.3 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +1 Query: 316 CAEIAHGVSSKKRKLIVERAQQLSIRVTN 402 C + HGV + K ++ER + +N Sbjct: 135 CQPVRHGVVDSETKFVIERKDSFTFLASN 163 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 24.2 bits (50), Expect = 9.7 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 187 LTLEPPADSVVNTSRFTPIPLKFVIAIRLMPDKSLRPLFDDC--RPVN 50 L + P ++ T+RF P+PL ++ ++ SL P + C P+N Sbjct: 569 LKVPPLVPLLIGTTRFFPVPL---VSSQIAIISSLGPSYSGCFQGPIN 613 >SPAC1F7.10 |||hydantoin racemase family |Schizosaccharomyces pombe|chr 1|||Manual Length = 238 Score = 24.2 bits (50), Expect = 9.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 91 KSLRPLFDDCRPVNRSYSHLVC 26 +S++ + DDC P N +L C Sbjct: 17 ESVKSVLDDCTPPNVQLEYLTC 38 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,835,019 Number of Sequences: 5004 Number of extensions: 35705 Number of successful extensions: 109 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -