BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20691 (459 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 3e-29 SB_3581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_15291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_16698| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 4.3 SB_28214| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) 28 4.3 SB_36033| Best HMM Match : ATP-synt_B (HMM E-Value=1) 27 5.6 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 27 7.5 SB_30037| Best HMM Match : ANATO (HMM E-Value=0.035) 27 7.5 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 124 bits (300), Expect = 3e-29 Identities = 53/71 (74%), Positives = 63/71 (88%) Frame = +2 Query: 41 IRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSN 220 + PV RP I+KKR K+FIRHQSDRY ++ +WRKP+GIDNRVRRRFKGQYLMPNIGYGSN Sbjct: 2 VMPVNRPRILKKRQKKFIRHQSDRYMRVGESWRKPKGIDNRVRRRFKGQYLMPNIGYGSN 61 Query: 221 KKTRHMLPNGF 253 KKTR ++P+GF Sbjct: 62 KKTRFLMPDGF 72 Score = 99.5 bits (237), Expect = 1e-21 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = +1 Query: 241 PKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 420 P K +VHNVKELE+LMM NR Y AEIAH VSS+KRK IVERAQQLSI+VTN+ ARLR Sbjct: 69 PDGFKKFVVHNVKELEVLMMMNRSYAAEIAHNVSSRKRKAIVERAQQLSIKVTNSNARLR 128 Query: 421 SQENE 435 S+ENE Sbjct: 129 SEENE 133 >SB_3581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 84 RDLSGINRIAMTNLRGIGVNLEVLTTESAGGS 179 +DL I A T+LR +G+N+E+L+ AGGS Sbjct: 169 KDLMAIVFFA-TDLREVGINIELLSMLPAGGS 199 >SB_15291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 28.3 bits (60), Expect = 3.2 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = +1 Query: 235 YAPKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAAR 414 Y PK K V K ++++ N YCA A SKK +L E+ ++L R + A Sbjct: 64 YEPKVSAKQRVEEFKGEDLIVRNNEVYCA--ACKEVSKKHELNKEKLKKLGKREEDIAQA 121 Query: 415 LRSQE 429 L + Sbjct: 122 LHKYD 126 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -3 Query: 235 MTGLLVGTVTNV--GHQV--LTLEPPADSVVNTSRFTPIPLKFVIAIRLMPDKSLRP 77 M G + T+T++ H+V L +EP A ++ T++FTP + F+ A + +RP Sbjct: 498 MYGTKLDTITDIIENHKVAILDVEPQALKILRTAKFTPY-VVFISAPSIKGINDIRP 553 >SB_16698| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 839 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +1 Query: 208 LRFQQEDPSYAPKWIPKVLVHNVKELEILMMQNRKYCAEIAHG-VSSKKRKLI 363 L+ Q+ PS P+ +++V ++E E+ RK+C EIA+ V S R+++ Sbjct: 272 LKCQKYWPSANPEEYGRLVVTPLEEEELSHYVIRKFCIEIANSDVESPAREIV 324 >SB_28214| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) Length = 361 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 393 SDAELLGSFHDQLPLLRRDTMSDLCAVLPVLHH 295 S+ E GSF D++ RRDT S +C +L H Sbjct: 300 SETERGGSFLDEVASPRRDTASPVCLWGAILFH 332 >SB_36033| Best HMM Match : ATP-synt_B (HMM E-Value=1) Length = 550 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 163 SPQAVQGSILDAQHWLRFQQE 225 SP+A+QG ++ AQ W +QE Sbjct: 151 SPEAIQGFLVSAQEWAIHRQE 171 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 27.5 bits (58), Expect = 5.6 Identities = 20/76 (26%), Positives = 34/76 (44%) Frame = +2 Query: 26 TYKMAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNI 205 +YK++ +P +P + + + SD+ DK+K K + RV KG+ + Sbjct: 14 SYKISAKPKSKPAPLDISAAQAMTSNSDKNDKMKVTTPKSKLGHRRVDE--KGETTYKKV 71 Query: 206 GYGSNKKTRHMLPNGF 253 G S K R +L F Sbjct: 72 GRLSAKPERDVLMQDF 87 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 420 AEASGRIRHSDAELLGSFHDQLPLLRRDTMSDLCAVLPVLHHQD 289 AEA+ R +ELL S ++LP +RR + + H D Sbjct: 247 AEATNDFRQELSELLASARERLPFMRRSLLEIEATAQEIPTHVD 290 >SB_30037| Best HMM Match : ANATO (HMM E-Value=0.035) Length = 124 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 361 SASASSKRHHERSLRSTSCFASSRFPAL*HCEL 263 S + +R +RS + ++C AS R P+ CEL Sbjct: 21 STEHAYQRRTKRSSKESACCASGRMPSRARCEL 53 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 26.6 bits (56), Expect = 9.9 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = -3 Query: 211 VTNVGHQVLTLEPPA---DSVVNTSRFTPIPLKFVIAIRLMPDKSLRPLFDDCRPVNRSY 41 V N+G + + EPP SVV+ S T PL FV++ + P +L L ++C NR + Sbjct: 3146 VNNLGSKFV--EPPVLDMSSVVDDSS-TRTPLIFVLSPGVDPTSALLQLAENCGMSNRFH 3202 Query: 40 S 38 + Sbjct: 3203 A 3203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,825,256 Number of Sequences: 59808 Number of extensions: 271692 Number of successful extensions: 1041 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -