BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20691 (459 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 156 9e-41 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 4.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 4.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 4.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 4.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 4.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 4.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 4.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 4.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 4.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 4.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 4.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 8.5 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 156 bits (379), Expect = 9e-41 Identities = 69/73 (94%), Positives = 71/73 (97%) Frame = +2 Query: 35 MAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYG 214 MAIRPVYRPTIVKKRTK+FIRHQSDRY KLKRNWRKP+GIDNRVRRRFKGQYLMPNIGYG Sbjct: 1 MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG 60 Query: 215 SNKKTRHMLPNGF 253 SNKKTRHMLP GF Sbjct: 61 SNKKTRHMLPTGF 73 Score = 110 bits (264), Expect = 8e-27 Identities = 55/65 (84%), Positives = 58/65 (89%) Frame = +1 Query: 241 PKWIPKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 420 P KVLVHNVKELE+LMMQNRK+CAEIAHG SSKKRK IVERAQQLSIRVT A+ARLR Sbjct: 70 PTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVTYASARLR 129 Query: 421 SQENE 435 SQENE Sbjct: 130 SQENE 134 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 303 KQEVLRRDRSWCLFEEAEAD 362 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 456 LIIQLYLFILLGAEASGRI 400 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 456 LIIQLYLFILLGAEASGRI 400 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 456 LIIQLYLFILLGAEASGRI 400 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 312 LPVLHHQDFQLFNI 271 LP L H D Q FN+ Sbjct: 1031 LPELRHGDIQGFNV 1044 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 8.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 312 LPVLHHQDFQLFNI 271 LP L H D Q FN+ Sbjct: 1027 LPELRHGDIQGFNV 1040 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,521 Number of Sequences: 438 Number of extensions: 2333 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -