BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS20690
(762 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces ... 26 6.7
SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po... 26 6.7
>SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces
pombe|chr 3|||Manual
Length = 227
Score = 25.8 bits (54), Expect = 6.7
Identities = 9/10 (90%), Positives = 10/10 (100%)
Frame = +3
Query: 51 IFSHYIYKVN 80
IFSHYIYK+N
Sbjct: 74 IFSHYIYKIN 83
>SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces
pombe|chr 3|||Manual
Length = 937
Score = 25.8 bits (54), Expect = 6.7
Identities = 11/32 (34%), Positives = 18/32 (56%)
Frame = -2
Query: 704 LENSYKKNLIIIRLEHFFHVNKIFNDFKSICF 609
L + KKN + E F H++ ++ DF+S F
Sbjct: 888 LMEALKKNSPSLNSEEFEHLSNLYRDFRSKLF 919
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,730,845
Number of Sequences: 5004
Number of extensions: 52041
Number of successful extensions: 95
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 95
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 95
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 365309308
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -