BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20690 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces ... 26 6.7 SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po... 26 6.7 >SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 227 Score = 25.8 bits (54), Expect = 6.7 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +3 Query: 51 IFSHYIYKVN 80 IFSHYIYK+N Sbjct: 74 IFSHYIYKIN 83 >SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 937 Score = 25.8 bits (54), Expect = 6.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 704 LENSYKKNLIIIRLEHFFHVNKIFNDFKSICF 609 L + KKN + E F H++ ++ DF+S F Sbjct: 888 LMEALKKNSPSLNSEEFEHLSNLYRDFRSKLF 919 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,730,845 Number of Sequences: 5004 Number of extensions: 52041 Number of successful extensions: 95 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -