BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20690 (762 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12640.1 68414.m01468 membrane bound O-acyl transferase (MBOA... 29 3.4 >At1g12640.1 68414.m01468 membrane bound O-acyl transferase (MBOAT) family protein low similarity to porcupine from [Xenopus laevis] GI:6714514, GI:6714520, GI:6714518, GI:6714516; contains Pfam profile PF03062: MBOAT family Length = 462 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 163 TPIAQNIRTIANVKVIFSLCTYL---YAM*RFTL*I**EKILLRNFSEKFYLSFTAR 2 +P IR I + +L YL Y + RFT + E LR FS ++ FTAR Sbjct: 203 SPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPVYQEWGFLRKFSYQYMAGFTAR 259 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,104,916 Number of Sequences: 28952 Number of extensions: 232309 Number of successful extensions: 292 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1702303248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -