BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20689 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14881| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_48430| Best HMM Match : PapG_C (HMM E-Value=3.6) 28 8.4 >SB_14881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = -1 Query: 691 DVQKIKINVDIKIGSPPPAGSK--NDVFKFRSVNNIVIAPAKTGS 563 D++ I + + PPP + +D+++F S NN+V+ P K S Sbjct: 524 DIRPIVLTCQVAKELPPPVMNYLVSDIYQFASNNNMVLNPKKCKS 568 >SB_48430| Best HMM Match : PapG_C (HMM E-Value=3.6) Length = 143 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = -1 Query: 679 IKINVDIKIGSPPPAGSKNDVFKF---RSVNNIVIAPAKTGSDNNNKNAVIPTAHTNKGN 509 I I++ I I PA S N+ R+VNN + K S N A T H + GN Sbjct: 64 ISISITITISITSPAKSNNNSISNNSNRNVNNSININGKNKSRNAEALATTATKHYDGGN 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,084,698 Number of Sequences: 59808 Number of extensions: 260814 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -