BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20686 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 40 0.003 SB_48913| Best HMM Match : TSP_1 (HMM E-Value=1.8e-11) 40 0.003 SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) 37 0.013 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_8067| Best HMM Match : TSP_1 (HMM E-Value=1.1e-22) 36 0.031 SB_25565| Best HMM Match : TSP_1 (HMM E-Value=0.0032) 36 0.041 SB_32913| Best HMM Match : TSP_1 (HMM E-Value=1.4e-16) 35 0.054 SB_58424| Best HMM Match : ADAM_spacer1 (HMM E-Value=8.5e-23) 35 0.054 SB_32444| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.071 SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24) 35 0.071 SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) 35 0.071 SB_18253| Best HMM Match : ADAM_spacer1 (HMM E-Value=4e-05) 34 0.094 SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) 33 0.17 SB_38612| Best HMM Match : TSP_1 (HMM E-Value=3.3e-11) 33 0.22 SB_12540| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.4e-07) 32 0.38 SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) 32 0.50 SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) 32 0.50 SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 0.67 SB_18837| Best HMM Match : Extensin_2 (HMM E-Value=1.7) 31 0.67 SB_19793| Best HMM Match : TSP_1 (HMM E-Value=0.0027) 31 0.67 SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_22060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_2827| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_57965| Best HMM Match : WSC (HMM E-Value=0.00054) 31 1.2 SB_33483| Best HMM Match : TSP_1 (HMM E-Value=0) 31 1.2 SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53071| Best HMM Match : TSP_1 (HMM E-Value=4.3e-05) 30 1.5 SB_12784| Best HMM Match : ADAM_spacer1 (HMM E-Value=1.4e-23) 30 1.5 SB_8177| Best HMM Match : TSP_1 (HMM E-Value=6e-38) 30 1.5 SB_51601| Best HMM Match : Toxin_23 (HMM E-Value=0.15) 30 2.0 SB_44750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 29 2.7 SB_54230| Best HMM Match : EGF (HMM E-Value=0) 29 2.7 SB_13711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 3.6 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 29 4.7 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 29 4.7 SB_54415| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) 29 4.7 SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 29 4.7 SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) 29 4.7 SB_20896| Best HMM Match : TSP_1 (HMM E-Value=4.8e-28) 29 4.7 SB_14947| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) 29 4.7 SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) 29 4.7 SB_42731| Best HMM Match : fn3 (HMM E-Value=1.7e-26) 28 6.2 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_31852| Best HMM Match : TSP_1 (HMM E-Value=4.2e-14) 28 6.2 SB_24278| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_25011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_58971| Best HMM Match : WSC (HMM E-Value=3.3) 28 8.2 SB_52932| Best HMM Match : Ank (HMM E-Value=0) 28 8.2 SB_26369| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_19921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_16252| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 28 8.2 SB_10243| Best HMM Match : Ank (HMM E-Value=0) 28 8.2 >SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +3 Query: 282 KQCRKPACV---HWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIK 452 + C+ P C W G W CS C G + + R+V C+D N ++S C + K Sbjct: 676 RPCQLPPCPPPNEWKTGPWRQCSVTC---GTGI-ETRTVECMDVEQNITQEESACAEKPK 731 Query: 453 PITTIKC 473 P TT +C Sbjct: 732 PHTTRRC 738 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 130 HSYRLSEWTPCSVTCGVGYTRRYYECIDQHQRVV-EQSQC 246 + ++ W CSVTCG G R EC+D Q + E+S C Sbjct: 687 NEWKTGPWRQCSVTCGTGIETRTVECMDVEQNITQEESAC 726 Score = 33.9 bits (74), Expect = 0.12 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 7/92 (7%) Frame = +3 Query: 282 KQCRKPACVHWWV-GAWNPCSKLCHMPGEEVTKERSVYCVDKV------MNKVVDDSECG 440 K C C WV G W C K C G + + R++YC K+ +++ V+ + C Sbjct: 612 KVCNIQPCPARWVPGEWKKCGKTC---GTGI-QLRNLYCRQKMDVDGRQVDRKVEINNCP 667 Query: 441 QVIKPITTIKCADVPAC*TICTRKYGPNNICS 536 Q +P T C +P C K GP CS Sbjct: 668 QWSRPKVTRPC-QLPPCPPPNEWKTGPWRQCS 698 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 124 KKHSYRLSEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQC 246 K H + S +T CSVTCG G R C Q + SQC Sbjct: 744 KTHWFIGSSFTSCSVTCGYGVKERLVFCGRQGGDALPDSQC 784 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 142 LSEWTPCSVTCGVGYTRRYYECI-DQHQRV 228 ++ W CS TCG G R C+ DQ +RV Sbjct: 1089 VTSWQKCSTTCGGGSQHRIVMCLNDQGKRV 1118 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 39.5 bits (88), Expect = 0.003 Identities = 28/93 (30%), Positives = 39/93 (41%), Gaps = 2/93 (2%) Frame = +3 Query: 201 RMH*STSTSGRTIPVLPH--EPPRHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVT 374 RM T R + V + P A ++C C W GAW CSK C G+ V Sbjct: 24 RMRRVTCADSRGVAVAERLCDAPNRPATYERCNVKPCTSWKHGAWGLCSKSC---GKGV- 79 Query: 375 KERSVYCVDKVMNKVVDDSECGQVIKPITTIKC 473 + R V C + K+ DS+C +P +C Sbjct: 80 QSRIVKCAYENW-KIAKDSQCDPFKRPPEQREC 111 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +3 Query: 282 KQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPIT 461 ++C+ PAC W VG W+ CS+ C G ++ R+V C + D C ++ KP T Sbjct: 254 RKCQLPACPEWTVGKWSECSRTC---GGGIS-ARTVTCSSR-------DQPCYRMSKPPT 302 Query: 462 TIKC 473 T C Sbjct: 303 TRIC 306 Score = 34.7 bits (76), Expect = 0.071 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYECI 210 + +W+ CSVTCG G RR EC+ Sbjct: 314 WNAGQWSQCSVTCGRGNIRRLVECV 338 Score = 34.3 bits (75), Expect = 0.094 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Frame = +1 Query: 148 EWTPCSVTCGVGYTRRYYEC------IDQHQRVVEQSQC 246 +W+ CSVTCG G +R EC D R +E+ +C Sbjct: 468 QWSQCSVTCGEGTRKRTVECNSGEKNCDMRSRPIERERC 506 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQC 246 S++ W CS +CG G R +C ++ ++ + SQC Sbjct: 62 SWKHGAWGLCSKSCGKGVQSRIVKCAYENWKIAKDSQC 99 Score = 33.1 bits (72), Expect = 0.22 Identities = 25/79 (31%), Positives = 38/79 (48%) Frame = +3 Query: 282 KQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPIT 461 ++C AC W VG W CS C GE V + R V C N+ DD+ KP Sbjct: 558 RKCNLGACPVWRVGPWEKCSVTC---GEGVVR-RVVTC-SAGGNRCQDDT------KP-E 605 Query: 462 TIKCADVPAC*TICTRKYG 518 +K ++P C + ++++G Sbjct: 606 VVKLCELPDCPSWLSQEWG 624 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYEC 207 +R+ W CSVTCG G RR C Sbjct: 568 WRVGPWEKCSVTCGEGVVRRVVTC 591 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYECIDQHQ 222 S+ EW CSVTCGVG R C Q + Sbjct: 617 SWLSQEWGECSVTCGVGLQSRPVRCDTQRK 646 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 Query: 273 ALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNK 416 A ++ C C W G W CSK C + + RSVYC ++K Sbjct: 401 ASVRVCALGECPTWKSGPWEKCSKTCGVG----FQARSVYCTASSVDK 444 Score = 31.1 bits (67), Expect = 0.88 Identities = 25/91 (27%), Positives = 38/91 (41%) Frame = +3 Query: 264 RHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQ 443 R + +C P C W G W CS C G V + R + C + ++C Sbjct: 147 RKPTQLLKCELPVCPQWNAGDWGQCSLTC---GGGV-QTRRIDCSSSL-------TKCDH 195 Query: 444 VIKPITTIKCADVPAC*TICTRKYGPNNICS 536 KP+ + +C + AC T + GP + CS Sbjct: 196 RKKPVESRRC-NTEAC--PATWREGPWSKCS 223 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQCYHMSR 261 + + +W+ CS TCG G + R C + Q CY MS+ Sbjct: 264 WTVGKWSECSRTCGGGISARTVTCSSRDQ------PCYRMSK 299 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 282 KQCRKPACVHWWVGAWNPCSKLC 350 + C C W VGAW+ CS C Sbjct: 354 RPCLMRPCAEWNVGAWSQCSVTC 376 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 160 CSVTCGVGYTRRYYEC 207 CSVTCG GY RR C Sbjct: 123 CSVTCGFGYKRREVYC 138 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYEC 207 +++ W CS TCGVG+ R C Sbjct: 413 TWKSGPWEKCSKTCGVGFQARSVYC 437 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 6/43 (13%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYEC------IDQHQRVVEQSQC 246 + +W CS+TCG G R +C D ++ VE +C Sbjct: 163 WNAGDWGQCSLTCGGGVQTRRIDCSSSLTKCDHRKKPVESRRC 205 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYEC 207 + + W+ CSVTCG G R C Sbjct: 364 WNVGAWSQCSVTCGSGKASRQVLC 387 >SB_48913| Best HMM Match : TSP_1 (HMM E-Value=1.8e-11) Length = 1068 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/72 (33%), Positives = 34/72 (47%) Frame = +3 Query: 306 VHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKCADVP 485 V W +G+W+ CS C PG ++ER V C+ V DS C KP+TT C Sbjct: 689 VQWKIGSWSACSNACG-PG---SQERDVACLRIDDGTYVRDSVCAGA-KPVTTQDCETAT 743 Query: 486 AC*TICTRKYGP 521 + T ++ P Sbjct: 744 CTASWYTTEWSP 755 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 6/68 (8%) Frame = +3 Query: 282 KQCRKPACV-HWWVGAWNPCSKLCHMPGEEVTKERSVYC-----VDKVMNKVVDDSECGQ 443 + C C W+ W+PCS C + T+ RSV C + K + DS C + Sbjct: 737 QDCETATCTASWYTTEWSPCSATC----GKGTQSRSVICRRETFTGSMQYKTLSDSNCAE 792 Query: 444 VIKPITTI 467 KP T+ Sbjct: 793 -NKPTVTL 799 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYEC 207 S+ +EW+PCS TCG G R C Sbjct: 747 SWYTTEWSPCSATCGKGTQSRSVIC 771 >SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2681 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWTPCS TCGVG R C Sbjct: 492 SEWTPCSTTCGVGIKTRKRSC 512 Score = 34.7 bits (76), Expect = 0.071 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WTPCSVTCGVG R C Sbjct: 789 SLWTPCSVTCGVGIMERNRFC 809 Score = 33.9 bits (74), Expect = 0.12 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEW+ C VTCG G +RY +C Sbjct: 293 SEWSICDVTCGGGVQQRYRDC 313 Score = 33.9 bits (74), Expect = 0.12 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WTPCSV+CG+G R C Sbjct: 903 SPWTPCSVSCGIGLKNRTRYC 923 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT CS TCG G+ R C Sbjct: 1455 SEWTGCSKTCGTGFRSRIRNC 1475 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S W+PC TCG G R +C Sbjct: 2251 STWSPCMKTCGTGVMMRQRDC 2271 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYECI-DQHQRVVEQSQ 243 W+ C+ TCG G+ R +C+ +H ++ Q + Sbjct: 850 WSTCTATCGGGFQERTRDCVPPKHGKMTCQDE 881 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WTPCS +C G R+ C Sbjct: 379 SPWTPCSRSCQAGVVSRHRIC 399 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WT CS TCG G R C Sbjct: 612 SNWTSCSATCGEGTMTRSRLC 632 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S W+ CSV+CG G R+ C Sbjct: 671 SAWSTCSVSCGGGVMFRHRNC 691 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECID 213 S+W CS +CG G R EC D Sbjct: 1143 SDWGSCSASCGPGKRIRTRECND 1165 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 37.1 bits (82), Expect = 0.013 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQC 246 S WTPCS TCG G+ R+ C E +C Sbjct: 963 SPWTPCSATCGTGHQMRWRFCFPLSSSKNESGEC 996 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQHQRV 228 S WT CSV+C G RY EC+ ++ RV Sbjct: 795 SNWTDCSVSCSSGQQVRYRECLKENVRV 822 Score = 32.3 bits (70), Expect = 0.38 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQH---QRVVEQSQCY 249 + W+ CSV+CGVG R C D E S CY Sbjct: 446 TSWSDCSVSCGVGARYRIRACPDSQVCAGNATESSYCY 483 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WT CSV+CG G R C Sbjct: 905 SNWTSCSVSCGSGVQVRTRSC 925 >SB_8067| Best HMM Match : TSP_1 (HMM E-Value=1.1e-22) Length = 869 Score = 35.9 bits (79), Expect = 0.031 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Frame = +3 Query: 273 ALMKQCRK-PACVHWWVGA-WNPCSKLCHMPGEEVTKERSVYCVDKVMNKV---VDDSEC 437 AL ++C C WV W+ CS+ C G + T R+V C K +N V + DS+C Sbjct: 610 ALSQKCENYDNCPAEWVATEWSACSQTC--AGGQQT--RTVTCKRKDLNSVYQSLSDSDC 665 Query: 438 GQVIKPITTIKCADVPAC 491 Q KP +C C Sbjct: 666 DQATKPTPQQECNSDVEC 683 Score = 35.1 bits (77), Expect = 0.054 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 94 QYTVDKQRLHKKHSYRLSEWTPCSVTCGVGYTRRYYEC 207 +Y + +L +KH + +EW PCS TCG G R C Sbjct: 365 RYVNQRDQL-EKHVWYKTEWNPCSATCGKGSQSRSVVC 401 Score = 33.9 bits (74), Expect = 0.12 Identities = 27/78 (34%), Positives = 32/78 (41%), Gaps = 5/78 (6%) Frame = +3 Query: 273 ALMKQCRK-PACVHWWVGA-WNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVD---DSEC 437 AL + C C WV W+ CS+ C G T R+V C K +N V DS C Sbjct: 426 ALSQNCENYDNCPAEWVATEWSACSQTC--AGGRQT--RTVTCKRKNLNGVYQSLADSNC 481 Query: 438 GQVIKPITTIKCADVPAC 491 Q KP KC C Sbjct: 482 DQATKPTPQQKCNSDVEC 499 Score = 33.5 bits (73), Expect = 0.17 Identities = 21/76 (27%), Positives = 30/76 (39%), Gaps = 3/76 (3%) Frame = +3 Query: 273 ALMKQCR-KPACVHWWVGAWNPCSKLCHMPGE--EVTKERSVYCVDKVMNKVVDDSECGQ 443 A ++C P W+ WNPCS C + V R ++ K + DS C Sbjct: 548 ASTQECEIAPCAASWYKTEWNPCSATCGKGSQSRSVVCRREIFAGSN-QYKTLPDSSC-T 605 Query: 444 VIKPITTIKCADVPAC 491 KP + KC + C Sbjct: 606 GSKPALSQKCENYDNC 621 Score = 32.7 bits (71), Expect = 0.29 Identities = 29/109 (26%), Positives = 44/109 (40%), Gaps = 1/109 (0%) Frame = +3 Query: 255 EPPRHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSE 434 +P Q P W G W+ CS C PG ++ R V C+ V DS Sbjct: 486 KPTPQQKCNSDVECPDHYQWSTGIWSECSFACG-PG---SQGRHVSCMRSDDGTYVADSF 541 Query: 435 CGQVIKPITTIKCADVPAC*TICTRKYGP-NNICSFINKIRITVMRKLI 578 C + KP +T +C P + ++ P + C ++ R V R+ I Sbjct: 542 C-EDAKPASTQECEIAPCAASWYKTEWNPCSATCGKGSQSRSVVCRREI 589 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYEC 207 S+ +EW PCS TCG G R C Sbjct: 561 SWYKTEWNPCSATCGKGSQSRSVVC 585 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 +EW+PCS TCG G R C Sbjct: 110 TEWSPCSATCGRGTQSRSVIC 130 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +3 Query: 312 WWVGAWNPCSKLCHMPGE--EVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKCADVP 485 W+ WNPCS C + V R ++ K + DS C KP + C + Sbjct: 378 WYKTEWNPCSATCGKGSQSRSVVCRREIFAGSN-QYKTLPDSSC-TGSKPALSQNCENYD 435 Query: 486 AC 491 C Sbjct: 436 NC 437 >SB_25565| Best HMM Match : TSP_1 (HMM E-Value=0.0032) Length = 88 Score = 35.5 bits (78), Expect = 0.041 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYECI-DQHQRVVEQSQCYHMSRR 264 W+ CSV CG G +R Y+C + +V+ CY ++R+ Sbjct: 35 WSECSVPCGGGMQKRIYDCYRKKDSMMVKYKLCYGVTRQ 73 >SB_32913| Best HMM Match : TSP_1 (HMM E-Value=1.4e-16) Length = 491 Score = 35.1 bits (77), Expect = 0.054 Identities = 22/72 (30%), Positives = 32/72 (44%) Frame = +3 Query: 306 VHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKCADVP 485 V W GAW+ CSK C + ++ER V C+ K V +S C KP +C Sbjct: 361 VEWKTGAWSACSKACGIG----SQERDVACLRKDDKTYVRESLCAG-SKPAANQECETAK 415 Query: 486 AC*TICTRKYGP 521 + T ++ P Sbjct: 416 CVSSWYTTEWSP 427 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYEC 207 S+ +EW+PCS TCG G R C Sbjct: 419 SWYTTEWSPCSATCGKGTQSRSVIC 443 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +1 Query: 76 NPGVTYQYTV--DKQRLHKKHSYRLSEWTPCSVTCGVGYTRRYYECIDQHQRV-VEQSQC 246 N VT++Y + + ++ W+ CS CG+G R C+ + + V +S C Sbjct: 341 NKAVTWKYLIPGNSSVSSSDVEWKTGAWSACSKACGIGSQERDVACLRKDDKTYVRESLC 400 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 273 ALMKQCRKPACVH-WWVGAWNPCSKLCHMPGEEVTKERSVYC 395 A ++C CV W+ W+PCS C + T+ RSV C Sbjct: 406 AANQECETAKCVSSWYTTEWSPCSATC----GKGTQSRSVIC 443 >SB_58424| Best HMM Match : ADAM_spacer1 (HMM E-Value=8.5e-23) Length = 487 Score = 35.1 bits (77), Expect = 0.054 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = +3 Query: 282 KQCRKPAC-VHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNK---VVDDSECGQVI 449 K C + C W+ G W CS+ C + RSV CV + N ++D EC + Sbjct: 140 KTCNENPCPATWYRGPWQTCSQSC----DRGVSVRSVLCVRSIKNDEQVALEDKECARP- 194 Query: 450 KPITTIKCADVP 485 +P++ C P Sbjct: 195 RPLSVRACYKRP 206 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 255 EPPRHQALMKQCRKPACVHWWVGAWNPCSKL 347 +P A ++C P C+ W G W S L Sbjct: 334 DPRARPAKHRKCSMPPCLAWKAGPWTKVSSL 364 >SB_32444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 34.7 bits (76), Expect = 0.071 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = +1 Query: 1 EKVRISGPLAEDIKVYQRIFRGRHRNPGVTYQ-YTVDKQRLHKKHSY-RLSEWTPCSVTC 174 E + I GP E +K+ F G+ N GV YQ Y K + + ++S W+ CS C Sbjct: 675 EWLYIRGPTKEKLKIVFIYFSGQ--NNGVDYQFYAPGKSTITPDQVWWKVSTWSACSKNC 732 Query: 175 GVGYTRRY 198 G RY Sbjct: 733 AGGPVPRY 740 >SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24) Length = 429 Score = 34.7 bits (76), Expect = 0.071 Identities = 21/68 (30%), Positives = 27/68 (39%) Frame = +3 Query: 288 CRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTI 467 C C W G W+ CS C + T+ R+V C DK D S C KP ++ Sbjct: 148 CNMGPCATWQTGTWSQCSVTC----GKGTQVRTVTCSDK------DTSACDLRTKPQSST 197 Query: 468 KCADVPAC 491 C C Sbjct: 198 VCGTSQEC 205 Score = 33.9 bits (74), Expect = 0.12 Identities = 30/104 (28%), Positives = 42/104 (40%), Gaps = 1/104 (0%) Frame = +3 Query: 255 EPPRHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSE 434 + P H A +C K C W GAW+ CS C G V + R V C + D Sbjct: 41 QKPPHVA---RCEKGECPRWTAGAWSECSSTC---GSGV-RTRFVSCKPR-------DGT 86 Query: 435 CGQVIKPITTIKCADVPAC*TICTRKYGPNNI-CSFINKIRITV 563 C KP +C DV C T ++ ++ C ++R V Sbjct: 87 CNSEDKPDAYKEC-DVMECPTWSVGQWSSCSVTCGVGRRLRSVV 129 Score = 33.1 bits (72), Expect = 0.22 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 142 LSEWTPCSVTCGVGYTRRYYECI 210 + W+ CS TCG+G T R +CI Sbjct: 210 IGNWSQCSRTCGIGITSREVQCI 232 Score = 31.1 bits (67), Expect = 0.88 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYEC 207 ++ + +W+ CSVTCGVG R C Sbjct: 106 TWSVGQWSSCSVTCGVGRRLRSVVC 130 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 160 CSVTCGVGYTRRYYECIDQHQRVVEQSQCYHMSR 261 CSVTCG G RR C + E + H++R Sbjct: 15 CSVTCGAGVKRRTVTCTSDNITCNESQKPPHVAR 48 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 133 SYRLSEWTPCSVTCGVGYTRRYYECIDQ 216 +++ W+ CSVTCG G R C D+ Sbjct: 155 TWQTGTWSQCSVTCGKGTQVRTVTCSDK 182 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 303 CVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKC 473 C W +G W+ CS+ C G +T R V C+ + N + + C +P+ C Sbjct: 205 CPKWIIGNWSQCSRTC---GIGIT-SREVQCI--LGNNSLPYASCDSNSRPVIRRVC 255 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYEC 207 W+ CS TCG G R+ C Sbjct: 62 WSECSSTCGSGVRTRFVSC 80 >SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) Length = 519 Score = 34.7 bits (76), Expect = 0.071 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQC 246 S W+PCS +CG G RR C++ R SQC Sbjct: 436 SSWSPCSQSCGRGLRRRVMMCVNLDDR-PPSSQC 468 >SB_18253| Best HMM Match : ADAM_spacer1 (HMM E-Value=4e-05) Length = 339 Score = 34.3 bits (75), Expect = 0.094 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +3 Query: 306 VHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKC 473 V W GAW+ CSK C + ++ER V C+ K V +S C KP +C Sbjct: 281 VEWKTGAWSACSKACGIG----SQERDVACLRKDDKTYVRESLCAG-SKPAANQEC 331 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +1 Query: 76 NPGVTYQYTV--DKQRLHKKHSYRLSEWTPCSVTCGVGYTRRYYECIDQHQRV-VEQSQC 246 N VT++Y + + ++ W+ CS CG+G R C+ + + V +S C Sbjct: 261 NKAVTWKYLIPGNSSVSSSDVEWKTGAWSACSKACGIGSQERDVACLRKDDKTYVRESLC 320 >SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 2675 Score = 33.5 bits (73), Expect = 0.17 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +3 Query: 282 KQCRKPACV-HWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSEC-GQVIKP 455 +QC C W++ W+ CS C G++V + V +++ D +C G KP Sbjct: 272 RQCNDSPCPPRWFISGWSACSSTCGQ-GKQVRRVHCEQVVSGGDTQMIPDDKCTGVGAKP 330 Query: 456 ITTIKCADVPAC 491 T C C Sbjct: 331 SGTRLCTLTRYC 342 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYECIDQHQRVVEQSQC 246 W PC+ +CGVG RR +C + E+ C Sbjct: 470 WQPCTRSCGVGLKRRQIKCFADSKEDPEEKWC 501 Score = 33.1 bits (72), Expect = 0.22 Identities = 22/64 (34%), Positives = 29/64 (45%) Frame = +3 Query: 294 KPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKC 473 K A W + ++ C+ C G +V R V+C KVVDD C KP T +C Sbjct: 219 KKAKYSWKMDGFSACTASC-AGGYQV---RRVFCARDRDGKVVDDIFCDYKSKPQTRRQC 274 Query: 474 ADVP 485 D P Sbjct: 275 NDSP 278 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYECIDQHQRVV 231 + S+W+ C+ TCG G R C +++ Sbjct: 405 WHASQWSRCTATCGTGMKMRNVVCAQDEGKIL 436 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +3 Query: 228 GRTIPVLPHEP-PRHQAL--MKQCR-KPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYC 395 G+ + V+P + R+ ++ +++C +P W++ W PC++ C + K R + C Sbjct: 433 GKILRVVPRDLCDRNHSMPSIEKCSTRPCQAGWYIFPWQPCTRSCGVG----LKRRQIKC 488 Query: 396 VDKVMNKVVDDSECGQVIKPITTIKC 473 + ++ C Q KP +C Sbjct: 489 FAD-SKEDPEEKWCDQETKPHDVERC 513 >SB_38612| Best HMM Match : TSP_1 (HMM E-Value=3.3e-11) Length = 900 Score = 33.1 bits (72), Expect = 0.22 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 4/74 (5%) Frame = +3 Query: 282 KQCRKPACVHWWVG-AWNPCSKLCHMPGEEVTKERSVYCVDKVMNKV---VDDSECGQVI 449 ++C K C WV AW+ CS+ C G + T R+V C K ++ V + D C I Sbjct: 770 QECNKVNCPAEWVSSAWSACSQTC--AGGQQT--RTVSCKQKDLDGVYQSLADFHCHHAI 825 Query: 450 KPITTIKCADVPAC 491 KP C +C Sbjct: 826 KPPPKQVCNSDLSC 839 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 +EW+PCS TCG G R C Sbjct: 720 TEWSPCSATCGRGTQSRSVIC 740 >SB_12540| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.4e-07) Length = 697 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Frame = +3 Query: 282 KQCRKPACV-HWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKV-MNKVVDDSECGQVIKP 455 + C + AC+ W G W+ CS C G +T+ ++V ++ + + C +KP Sbjct: 552 RACAQTACLPEWQAGDWSECSASC--GGGIITRPLKCTRKNRVGVSVTIHNLLCHHSLKP 609 Query: 456 ITTIKC-ADVP 485 T + C DVP Sbjct: 610 TTEMACNQDVP 620 >SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) Length = 718 Score = 31.9 bits (69), Expect = 0.50 Identities = 22/73 (30%), Positives = 32/73 (43%) Frame = +3 Query: 255 EPPRHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSE 434 +PP QA C K C W G W CS C G + R V C + + ++ D + Sbjct: 599 KPPSTQA----CFKQPCDEWATGNWGECSAKC---GSGY-QRRLVKCRNALTRQLSD--K 648 Query: 435 CGQVIKPITTIKC 473 C Q +P+ +C Sbjct: 649 CPQRTRPVDVRQC 661 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 288 CRKPACVHWW-VGAWNPCSKLC 350 C AC WW V +W PCS C Sbjct: 496 CNDHACPVWWFVSSWQPCSSKC 517 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYEC 207 W CS CG GY RR +C Sbjct: 619 WGECSAKCGSGYQRRLVKC 637 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = +3 Query: 279 MKQCRKPAC-VHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKP 455 ++ C AC + W+ G W+ C +C + + R V C ++ +C Q+ KP Sbjct: 553 VRNCINKACHLKWYTGQWSKCFAMCGVG----RRRRLVRC-PRI-------GKCSQLTKP 600 Query: 456 ITTIKCADVPAC*TICTRKYG 518 +T C P C T +G Sbjct: 601 PSTQACFKQP-CDEWATGNWG 620 >SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +3 Query: 306 VHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNK---VVDDSECGQVIKPITTIKCA 476 V W +G W+ CS C GE + + RS+ C + N ++ S+C I P +KC Sbjct: 300 VEWNIGPWSKCSVSC---GEGI-RRRSIACRQTLANATIIILPVSKC-PGIPPAIMVKCK 354 Query: 477 D 479 D Sbjct: 355 D 355 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYEC 207 + + W+ CSV+CG G RR C Sbjct: 302 WNIGPWSKCSVSCGEGIRRRSIAC 325 >SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) Length = 649 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYEC 207 Y S+++ CSVTCG G RY +C Sbjct: 302 YHWSKFSSCSVTCGRGVKERYRKC 325 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S ++ CSVTCGVG R +C Sbjct: 386 SGYSKCSVTCGVGKRTRSRQC 406 >SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1219 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S+WT CSVTCG G +R C Sbjct: 202 SKWTECSVTCGGGTRQRERSC 222 >SB_18837| Best HMM Match : Extensin_2 (HMM E-Value=1.7) Length = 626 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 681 VADNCNVRTLKPQGSWYTARPSGLCFRAHNR 589 + + + RTL P G WYT PSG C R + + Sbjct: 1 MVNRTSFRTLSP-GEWYTGPPSGPCHRGNGK 30 Score = 31.1 bits (67), Expect = 0.88 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 660 RTLKPQGSWYTARPSGLCFRAHNR 589 RTL P G WYT PSG C R + + Sbjct: 249 RTLSP-GEWYTEAPSGPCHRGNGK 271 Score = 31.1 bits (67), Expect = 0.88 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 690 TQDVADNCNVRTLKPQGSWYTARPSGLCFRAH 595 T + + + RTL P G WYT PSG C R + Sbjct: 321 TGGMVNKSSFRTLSP-GEWYTEPPSGPCHRGN 351 Score = 31.1 bits (67), Expect = 0.88 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 690 TQDVADNCNVRTLKPQGSWYTARPSGLCFRAH 595 T + + + RTL P G WYT PSG C R + Sbjct: 362 TGGMVNRTSFRTLSP-GEWYTEPPSGPCHRGN 392 Score = 31.1 bits (67), Expect = 0.88 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 690 TQDVADNCNVRTLKPQGSWYTARPSGLCFRAH 595 T + + + RTL P G WYT PSG C R + Sbjct: 485 TGGMVNRSSFRTLSP-GEWYTEPPSGPCHRGN 515 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 660 RTLKPQGSWYTARPSGLCFRAHNR 589 RTL P G WYT PSG C R + + Sbjct: 49 RTLSP-GEWYTEPPSGPCHRGNGK 71 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 660 RTLKPQGSWYTARPSGLCFRAHNR 589 RTL P G WYT PSG C R + + Sbjct: 413 RTLSP-GEWYTEPPSGPCHRGNGK 435 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 660 RTLKPQGSWYTARPSGLCFRAHNR 589 RTL P G WYT PSG C R + + Sbjct: 454 RTLSP-GEWYTEPPSGPCHRGNGK 476 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 690 TQDVADNCNVRTLKPQGSWYTARPSGLCFRAHNR 589 T + + + +TL P G WYT P G C R + + Sbjct: 80 TGGMVNRSSFKTLSP-GEWYTEPPLGSCHRGNGK 112 >SB_19793| Best HMM Match : TSP_1 (HMM E-Value=0.0027) Length = 384 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +3 Query: 282 KQCRKPACVHWWV-GAWNPCSKLCHMPGEEVTKERSVYCVDKVMN---KVVDDSEC 437 K C C W G W+ C+ + PG++ T RSV C +++ N ++D+ EC Sbjct: 312 KTCNVVDCGPGWEKGEWSVCAGV---PGQQGTSTRSVECRNRMANGSFPLLDEEEC 364 >SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 31.5 bits (68), Expect = 0.67 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 64 GRHRNPGVTYQYTVDKQRLHKKHSYRLSEWTPCSVTCGVG 183 GR R ++ D R+ + ++ S+WT CSVTCGVG Sbjct: 934 GRLRLERSALNHSSDPSRIDCQLTH-WSKWTSCSVTCGVG 972 >SB_22060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 842 Score = 31.1 bits (67), Expect = 0.88 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 142 LSEWTPCSVTCGVGYTRRYYEC 207 L+ W+PCSVTCG G R C Sbjct: 648 LNLWSPCSVTCGHGIQARARPC 669 >SB_2827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 31.1 bits (67), Expect = 0.88 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 139 RLSEWTPCSVTCGVGYTRRYYEC 207 R SEW+ CSVTC G R+ C Sbjct: 296 RWSEWSSCSVTCDNGVQSRHRSC 318 >SB_57965| Best HMM Match : WSC (HMM E-Value=0.00054) Length = 221 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +3 Query: 312 WWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVM---NKVVDDSECGQVIKPITTIKC 473 W V ++ CSK C G T R++ C+ KV N+ +DDS C KP +C Sbjct: 2 WVVSHYSECSKSC--AGGVQT--RALECMQKVTQSSNERLDDSACTNATKPAVIREC 54 >SB_33483| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 372 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT C+VTCG G R C Sbjct: 243 SEWTSCTVTCGGGEQMRSRTC 263 >SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1286 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 76 NPGVTYQYTVD-KQRLHKKHSYRL-SEWTPCSVTCGVGYTRRYYEC 207 NPG+ + + + L Y L S+W+PC VTCG R C Sbjct: 296 NPGLIWYWMREPSSALKLAGGYNLWSDWSPCPVTCGGAMQLRTRNC 341 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WT C+VTCG G R C Sbjct: 16 SNWTECTVTCGSGKQFRTRNC 36 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WT CS TCG G R +C Sbjct: 383 SAWTECSATCGGGTQMRNRKC 403 >SB_53071| Best HMM Match : TSP_1 (HMM E-Value=4.3e-05) Length = 755 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = +3 Query: 312 WWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIKC 473 W W CS C G E + R +YCV N S C ++P + C Sbjct: 141 WATSNWTSCSTTC--AGGE--RSRVLYCVRSDDNTFASHSACDAALRPASVEAC 190 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYEC 207 W+ CS TC G T R EC Sbjct: 293 WSECSTTCSTGVTTRQLEC 311 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/73 (26%), Positives = 29/73 (39%), Gaps = 3/73 (4%) Frame = +1 Query: 1 EKVRISGPLAEDIKVYQRIFRGRHRNPGVTYQYTVDKQRL---HKKHSYRLSEWTPCSVT 171 +++ I GP E K+ + N GV Y + + + + S WT CS T Sbjct: 95 DRILIEGPTTE--KLLLKFVYVYEVNGGVDIDYFRPVSGVLGSNVSYQWATSNWTSCSTT 152 Query: 172 CGVGYTRRYYECI 210 C G R C+ Sbjct: 153 CAGGERSRVLYCV 165 >SB_12784| Best HMM Match : ADAM_spacer1 (HMM E-Value=1.4e-23) Length = 571 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +1 Query: 1 EKVRISGPLAEDIKVYQRIFRGRHRNPGVTYQYTVDKQRLHKKHSYRLSEWTPCSVTCGV 180 E ++I+G ED+ + + + G+ P V Y V HK + + WTPC+ C Sbjct: 488 EMIKITGKTQEDL-LLEVLSVGKLTPPNVHYSLNVPFIGPHK-FKWIIKRWTPCNRLCQG 545 Query: 181 G 183 G Sbjct: 546 G 546 >SB_8177| Best HMM Match : TSP_1 (HMM E-Value=6e-38) Length = 950 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S WT C+ TCG G +R +C Sbjct: 238 SSWTSCTKTCGTGMQKRSRDC 258 >SB_51601| Best HMM Match : Toxin_23 (HMM E-Value=0.15) Length = 149 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 282 KQCRKPA-CVHWWVGAWNPCSKLCHMPGEEVTK 377 K+C+K C+ W + + CS LCH P +E K Sbjct: 82 KECKKSCECIPWGQLSVSICSPLCHAPIDECFK 114 >SB_44750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2190 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SE+TPCS TCG G R C Sbjct: 260 SEYTPCSKTCGGGTRHRTRSC 280 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 +E++PCSVTCG G + R C Sbjct: 319 TEFSPCSVTCGRGLSTRSRAC 339 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S W+PC TCG G R +C Sbjct: 229 STWSPCMKTCGTGVMMRQRDC 249 >SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) Length = 326 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 +EW+ CS TCG G+ R C Sbjct: 148 TEWSACSKTCGAGHRLRRRSC 168 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S W+ CSVTC +G R +C Sbjct: 204 SSWSSCSVTCDLGTKTRTRKC 224 >SB_54230| Best HMM Match : EGF (HMM E-Value=0) Length = 1359 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYECIDQH 219 W+PCSVTCG R C + H Sbjct: 1138 WSPCSVTCGNDNETRTRTCSNPH 1160 >SB_13711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -2 Query: 168 DGARRPFGQSVAVFLVKSLFVDRVLVCYARVAMSSSEYTLINFYIF 31 D +R+ F + L+ +F++ L+CY + + NFY+F Sbjct: 95 DSSRKVFASLQGMLLLLGIFINS-LICYVMIRRQKIHRSTANFYLF 139 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 414 KVVDDSECGQVIKPITTIKCADVPAC 491 +V+ + ECGQ+ P +T++C + C Sbjct: 1108 RVIFEGECGQIADPCSTVQCPNNGRC 1133 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRR 195 S W+PCS CGVG +R Sbjct: 519 SRWSPCSHRCGVGMRKR 535 >SB_50954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 768 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQCYHMSRRD 267 S WT CSVTC G R C++ R +++ C +R + Sbjct: 303 SNWTTCSVTCSGGVQSRTRFCLNPF-RGLDRPACRGDNREE 342 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQHQRV 228 S W PC+VTC R +C+D R+ Sbjct: 582 SPWYPCNVTCPGRIQSRSKKCLDPEGRL 609 >SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT C+ TCG G R C Sbjct: 445 SEWTKCTKTCGGGKQERTRTC 465 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +3 Query: 249 PHEPPRHQALMKQCRKPACVH--W--WVGAWNPCSKLCHMPGEEVTKER 383 P EP + + C KP + W W GAW CSK C PG+ + + + Sbjct: 250 PCEPSDAKETKEDCTKPCEIDGGWGEW-GAWAECSKTCG-PGKLIRRRK 296 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 28.7 bits (61), Expect = 4.7 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 4/97 (4%) Frame = +3 Query: 255 EPPRHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKV---VD 425 +PPR + M R+P W W C++ C+ G T R V C+ + V VD Sbjct: 1131 KPPRQE--MHCNRQPCPPVWKAEGWEDCTRTCN--GGNRT--RQVKCMQVAADGVEYDVD 1184 Query: 426 DSECGQVIKPITTIKCADVPAC*TICTRKYGP-NNIC 533 C +P T C VP + +GP + +C Sbjct: 1185 QRLCLDP-RPPTVEACNTVPCLPEWVAQPFGPCSTVC 1220 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 136 YRLSEWTPCSVTCGVGYTRRYYEC 207 Y E T CSV+CG G R Y +C Sbjct: 1089 YWAVEKTGCSVSCGGGAERSYAQC 1112 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = +1 Query: 76 NPGVTYQYTVDKQ-----RLH-KKHSYRLSEWTPCSVTCGVGYTRRY 198 NP + Q +D + LH K + S+W+ CS TCG G R+ Sbjct: 11 NPAIQLQPLIDDEIIALIPLHIKLLKFNRSKWSTCSKTCGSGKQSRF 57 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYECIDQHQRVVEQSQCYHMSRRD 267 S WT CSVTC G R C++ R +++ C +R + Sbjct: 154 SNWTTCSVTCSGGVQSRTRFCLNPF-RGLDRPACRGDNREE 193 >SB_54415| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) Length = 612 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT C+ TCG G R C Sbjct: 107 SEWTKCTKTCGGGKQERTRTC 127 >SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 468 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +3 Query: 249 PHEPPRHQALMKQCRKPACVH--W--WVGAWNPCSKLCHMPGEEVTKER 383 P EP + + C KP + W W GAW CSK C PG+ + + + Sbjct: 206 PCEPSDAKETKEDCTKPCEIDGGWGEW-GAWAECSKTCG-PGKLIRRRK 252 >SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 446 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT C+ TCG G R C Sbjct: 360 SEWTKCTKTCGGGKQERTRTC 380 >SB_20896| Best HMM Match : TSP_1 (HMM E-Value=4.8e-28) Length = 588 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEW+ CS CG G RR +C Sbjct: 340 SEWSRCSRQCGGGVHRRIRDC 360 >SB_14947| Best HMM Match : TSP_1 (HMM E-Value=6.8e-21) Length = 666 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT C+ TCG G R C Sbjct: 92 SEWTKCTKTCGGGKQERTRTC 112 >SB_5403| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 684 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 SEWT C+ TCG G R C Sbjct: 476 SEWTKCTKTCGGGKQERTRTC 496 >SB_42731| Best HMM Match : fn3 (HMM E-Value=1.7e-26) Length = 671 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 148 EWTPCSVTCGVGYTRRYYECI 210 EW+ CS TCG G R CI Sbjct: 254 EWSACSATCGDGTQSRDRTCI 274 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 6.2 Identities = 24/93 (25%), Positives = 37/93 (39%) Frame = +3 Query: 243 VLPHEPPRHQALMKQCRKPACVHWWVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVV 422 VL H R Q + P C W+V W ++ SV+ + + + V Sbjct: 77 VLEHYQARSQHGTRMEGVPVC--WYVSVWGLSPQVSQCDSVSAV---SVWGLSTQVTQCV 131 Query: 423 DDSECGQVIKPITTIKCADVPAC*TICTRKYGP 521 S CGQ + P+T D P C + ++ GP Sbjct: 132 SASACGQRMGPLTK---GD-PGCYGVSGQRMGP 160 >SB_31852| Best HMM Match : TSP_1 (HMM E-Value=4.2e-14) Length = 162 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 145 SEWTPCSVTCGVG 183 SEW+ CSVTCG G Sbjct: 110 SEWSTCSVTCGGG 122 >SB_24278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 363 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 151 WTPCSVTCGVGYTRRYYECIDQHQRVVEQSQC 246 W CSV CG G +R C Q + + C Sbjct: 202 WGECSVRCGAGQQKRRVFCAKQDGKPLAPKYC 233 >SB_25011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 145 SEWTPCSVTCGVG 183 SEW+ CSVTCG G Sbjct: 475 SEWSTCSVTCGGG 487 >SB_58971| Best HMM Match : WSC (HMM E-Value=3.3) Length = 146 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 315 WVGAWNPCSKLCHMPGEEVTKERSVYCVDKVMNKVVDDSECGQVIKPITTIK-CADV 482 W G + ++ +V+ E +V C+ N VDD +C + KP ++ C DV Sbjct: 88 WSGVGGSNANFVYVFTSKVS-EPTVRCISMETNTAVDDEKCDKSKKPPCDLRLCQDV 143 >SB_52932| Best HMM Match : Ank (HMM E-Value=0) Length = 1266 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 154 TPCSVTCGVGYTRRYYECIDQHQRVVEQ 237 TP + T G T YY ++ H+ VVEQ Sbjct: 851 TPINQTTDSGNTALYYAAMEGHEEVVEQ 878 >SB_26369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S W+ C VTCG G R C Sbjct: 238 SNWSACPVTCGAGSQARTRNC 258 >SB_26365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S W+ C VTCG G R C Sbjct: 261 SNWSACPVTCGAGSQARTRNC 281 >SB_19921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 145 SEWTPCSVTCGVGYTRRYYEC 207 S+W+ CS TCG+G R C Sbjct: 364 SDWSVCSKTCGLGEKSRERTC 384 >SB_16252| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 580 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 130 HSYRLSEWTPCSVTCGVGYTRRYYECID 213 H R S W+ CS TCG G R C D Sbjct: 310 HWGRWSVWSACSQTCGDGTQTRTRVCDD 337 >SB_10243| Best HMM Match : Ank (HMM E-Value=0) Length = 475 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 154 TPCSVTCGVGYTRRYYECIDQHQRVVEQ 237 TP + T G T YY ++ H+ VVEQ Sbjct: 47 TPINQTTDSGNTALYYAAMEGHEEVVEQ 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,625,916 Number of Sequences: 59808 Number of extensions: 486662 Number of successful extensions: 1595 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -