BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20684 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 0.84 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 25 0.84 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 4.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.8 AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone recepto... 21 7.8 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 355 PQISSSHQSLSFLWHHRSQMHRCFLQHHHFQQANFWG 245 P +++ + + HH + H Q HH QQ +G Sbjct: 155 PPLTTQSMNNHHMGHHMQEQHPQHHQPHHQQQHMMYG 191 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 355 PQISSSHQSLSFLWHHRSQMHRCFLQHHHFQQANFWG 245 P +++ + + HH + H Q HH QQ +G Sbjct: 157 PPLTTQSMNNHHMGHHMQEQHPQHHQPHHQQQHMMYG 193 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 490 SMPIRVHSHPHIPLL 534 ++PI V HP IPLL Sbjct: 538 TIPIHVWIHPWIPLL 552 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 43 HVLRTTENNAHCTK 2 H+L +TE N CTK Sbjct: 1355 HILASTELNLCCTK 1368 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 43 HVLRTTENNAHCTK 2 H+L +TE N CTK Sbjct: 1355 HILASTELNLCCTK 1368 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 43 HVLRTTENNAHCTK 2 H+L +TE N CTK Sbjct: 1355 HILASTELNLCCTK 1368 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 43 HVLRTTENNAHCTK 2 H+L +TE N CTK Sbjct: 1355 HILASTELNLCCTK 1368 >AM295016-1|CAL25731.1| 96|Tribolium castaneum ecdysone receptor (isoform B) protein. Length = 96 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 131 VAPEEVTSTEPKESPVKKSPAKKVEAAE 214 VAPEE +S S + SPA + + + Sbjct: 9 VAPEESSSEVTSSSALVMSPANSLASTD 36 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,828 Number of Sequences: 336 Number of extensions: 3126 Number of successful extensions: 18 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -