BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20680 (722 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 28 1.2 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 27 2.7 SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|... 26 4.7 SPAC2E1P3.04 |||copper amine oxidase |Schizosaccharomyces pombe|... 26 6.3 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 28.3 bits (60), Expect = 1.2 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -2 Query: 526 CPYASLHFFSSILFPLGCISVKNIICDLQQCFIQNFI 416 C Y ++ L+P GC +K ++ L++C + FI Sbjct: 1206 CRYRQFDSLTASLYPEGCYQLKPVLEWLKRCILSIFI 1242 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 27.1 bits (57), Expect = 2.7 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -2 Query: 526 CPYASLHFFSSILFPLGCISVKNIICDLQQCFIQNFI 416 C Y + ++ L+P GC +K ++ +++C I FI Sbjct: 1298 CDYQAGAAINASLYPPGCYMLKPVLDWIRRCIISIFI 1334 >SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|||Manual Length = 834 Score = 26.2 bits (55), Expect = 4.7 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +2 Query: 44 TILYDDV--PPKRFKTFVYNSKCVYN*RAT 127 T+L+D++ PP +F+T YN VY RAT Sbjct: 747 TVLHDEIQMPPDQFQTLCYNLCYVYA-RAT 775 >SPAC2E1P3.04 |||copper amine oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 712 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 469 SVKNIICDLQQCFIQNF-ICNPYHLQPY*G 383 +VK ICD + + ICNP L PY G Sbjct: 509 TVKEAICDYNSDTSRTWDICNPNKLHPYSG 538 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,552,165 Number of Sequences: 5004 Number of extensions: 51402 Number of successful extensions: 153 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -