BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20680 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 24 5.5 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 24 5.5 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 24 5.5 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 24 5.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 9.6 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 580 LYFPSQVSFWLLDILLMHCPYASLHFFSSILFPL 479 L FP Q++ L + + P+ LHFF PL Sbjct: 136 LRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPL 169 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 580 LYFPSQVSFWLLDILLMHCPYASLHFFSSILFPL 479 L FP Q++ L + + P+ LHFF PL Sbjct: 136 LRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPL 169 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 580 LYFPSQVSFWLLDILLMHCPYASLHFFSSILFPL 479 L FP Q++ L + + P+ LHFF PL Sbjct: 136 LRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPL 169 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 580 LYFPSQVSFWLLDILLMHCPYASLHFFSSILFPL 479 L FP Q++ L + + P+ LHFF PL Sbjct: 136 LRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPL 169 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 595 QQSHFLYFPSQVSFWLLDILLMHCPYASLH 506 Q+SH++ +PS V + M+ P A H Sbjct: 1120 QESHYVMYPSNVPVFAGGAEYMNVPAAVTH 1149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,102 Number of Sequences: 2352 Number of extensions: 12494 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -