BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20676 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.0 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 25 3.2 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.2 bits (55), Expect = 1.0 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -3 Query: 722 ASKFNALTSRGAGGREGSHRLSTA 651 +SKF+ +SRG+G GSH +S+A Sbjct: 1345 SSKFST-SSRGSGSDSGSHSISSA 1367 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 24.6 bits (51), Expect = 3.2 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -1 Query: 682 GGR-ARIASQLLEAPALRRTRRRSYFVQ-----QFDVELKLNSQY 566 GGR A ++ +++ + LRR R RS +FD+ LKL S+Y Sbjct: 212 GGRYAMLSMKVMLSSILRRLRLRSDLQMNDLQFRFDLTLKLESEY 256 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,173 Number of Sequences: 2352 Number of extensions: 13122 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -