Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20673
         (713 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     23   3.8  

>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 20/73 (27%), Positives = 27/73 (36%), Gaps = 9/73 (12%)
 Frame = +1

Query: 55  KNVSAAIHPGIPTEPPSRSGLRTGAYSGRSPDGRHHAN---------DVQRLLPSVEADG 207
           + V A++ P  P  P   S     AY+    D   H           D + LLP V   G
Sbjct: 172 QTVVASMDPPEPPVPTVTSACVGSAYTPLKEDHDDHYGVPTLEELGFDTEGLLPPVWVGG 231

Query: 208 DRQ*RRRFHHHLE 246
           + +   R   HLE
Sbjct: 232 ESEALARLERHLE 244


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,400
Number of Sequences: 438
Number of extensions: 3561
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)