Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20671
         (493 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol ...    23   7.5  
CR954257-6|CAJ14157.1|  375|Anopheles gambiae RrnaAD, ribosomal ...    22   9.9  

>AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol
           kinase protein.
          Length = 555

 Score = 22.6 bits (46), Expect = 7.5
 Identities = 11/42 (26%), Positives = 18/42 (42%)
 Frame = +2

Query: 251 ENGKRVHILPIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDD 376
           +N K +  +   + + G   +  +VY  P F   Y P  R D
Sbjct: 333 DNLKIIKDIKDSEEIAGSVSSTGDVYFVPAFTGLYAPYWRKD 374


>CR954257-6|CAJ14157.1|  375|Anopheles gambiae RrnaAD, ribosomal RNA
           adenine dimethylaseprotein.
          Length = 375

 Score = 22.2 bits (45), Expect = 9.9
 Identities = 8/10 (80%), Positives = 10/10 (100%)
 Frame = -1

Query: 274 YVDSFSIFTE 245
           YVD+F+IFTE
Sbjct: 297 YVDNFNIFTE 306


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 557,492
Number of Sequences: 2352
Number of extensions: 11258
Number of successful extensions: 14
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 43554477
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)