BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20666 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 23 2.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 5.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.6 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = -1 Query: 512 CPIIGYERKCSIRPTRSSNCSPLPTSYLLC 423 CP + P R N PLPT + C Sbjct: 14 CPDLDNVTMPETTPRRKKNKKPLPTECVFC 43 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 499 PMIGHQETYCVSCS 540 P +GH + CV+CS Sbjct: 380 PAMGHWQMSCVACS 393 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 576 DQKVQEMQGIEDRQKMECNTGFDGEFQS 659 DQ++ G+ D ++E T +G+F S Sbjct: 223 DQRINYHFGMTDNSRLEPGTNKNGKFFS 250 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,606 Number of Sequences: 438 Number of extensions: 4939 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -