BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20663 (488 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 81 5e-16 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 76 1e-14 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 76 1e-14 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 76 1e-14 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 71 3e-13 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 66 1e-11 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 46 1e-05 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 46 1e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 46 2e-05 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 45 3e-05 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 44 4e-05 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 43 1e-04 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 43 1e-04 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 43 1e-04 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 42 2e-04 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 42 2e-04 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 41 4e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 40 7e-04 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 40 9e-04 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 39 0.002 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 39 0.002 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 39 0.002 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 38 0.003 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 38 0.003 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 38 0.004 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 36 0.011 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 36 0.015 At4g27940.1 68417.m04009 mitochondrial substrate carrier family ... 36 0.019 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 35 0.026 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 35 0.026 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 35 0.026 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 35 0.026 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 35 0.034 At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 34 0.059 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 33 0.078 At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id... 33 0.078 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 33 0.078 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 33 0.10 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 31 0.32 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 31 0.55 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 31 0.55 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 31 0.55 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 31 0.55 At4g22590.1 68417.m03259 trehalose-6-phosphate phosphatase, puta... 30 0.73 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 30 0.73 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 30 0.73 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 30 0.96 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 29 1.3 At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA... 29 1.7 At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA... 29 1.7 At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA... 29 1.7 At4g39460.1 68417.m05583 mitochondrial substrate carrier family ... 29 2.2 At4g18600.1 68417.m02755 expressed protein 29 2.2 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 28 2.9 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 28 2.9 At5g26200.1 68418.m03118 mitochondrial substrate carrier family ... 28 3.9 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 28 3.9 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 27 5.1 At1g71680.1 68414.m08271 lysine and histidine specific transport... 27 5.1 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 27 6.8 At2g34720.1 68415.m04264 CCAAT-binding transcription factor (CBF... 27 6.8 At4g12430.1 68417.m01967 trehalose-6-phosphate phosphatase, puta... 27 9.0 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 27 9.0 At2g17090.1 68415.m01973 protein kinase family protein similar t... 27 9.0 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 27 9.0 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 80.6 bits (190), Expect = 5e-16 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 YKGI D F R K++G+L+ WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 123 YKGISDCFARTVKDEGMLALWRGNTANVIRYFPTQALNFAFKDYFKRLF 171 Score = 51.2 bits (117), Expect = 4e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 F DFL GG+SAAVSKTA APIERVKLL+Q Q Sbjct: 79 FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ 110 Score = 35.1 bits (77), Expect = 0.026 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = +3 Query: 435 QEDAFWRYFAGNLASGGA 488 ++D +W++FAGNLASGGA Sbjct: 176 EKDGYWKWFAGNLASGGA 193 Score = 30.7 bits (66), Expect = 0.55 Identities = 21/61 (34%), Positives = 32/61 (52%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHS 450 +YK + AF +I K +G S ++G AN++R + A DK + + LG KK S Sbjct: 321 KYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGV-LAGYDKLQLIVLG---KKYGS 376 Query: 451 G 453 G Sbjct: 377 G 377 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 75.8 bits (178), Expect = 1e-14 Identities = 35/55 (63%), Positives = 42/55 (76%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 438 YKGI D F R +++G+ S WRGN ANVIRYFPTQALNFAFKD +K++F DK Sbjct: 128 YKGIRDCFGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDK 182 Score = 52.4 bits (120), Expect = 2e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 FA DF+ GG+SAAVSKTA APIERVKLL+Q Q Sbjct: 84 FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQ 115 Score = 34.3 bits (75), Expect = 0.045 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +3 Query: 438 EDAFWRYFAGNLASGGA 488 +D +W++FAGNLASGGA Sbjct: 182 KDGYWKWFAGNLASGGA 198 Score = 31.1 bits (67), Expect = 0.42 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 363 +YK DAF +I K++G S ++G AN++R Sbjct: 327 KYKSSFDAFSQIVKKEGAKSLFKGAGANILR 357 Score = 29.1 bits (62), Expect = 1.7 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +1 Query: 265 DQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 429 ++++ G+VD + + K G+ +RG + + L F D K V L G Sbjct: 230 ERQFNGLVDVYKKTLKSDGIAGLYRGFNISCAGIIVYRGLYFGLYDSVKPVLLTG 284 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 75.8 bits (178), Expect = 1e-14 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 YKGI D F R K++G S WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 124 YKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLF 172 Score = 53.6 bits (123), Expect = 7e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 FA DFL GG+SAAVSKTA APIERVKLL+Q Q Sbjct: 80 FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQ 111 Score = 33.9 bits (74), Expect = 0.059 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 441 DAFWRYFAGNLASGGA 488 D +W++FAGNLASGGA Sbjct: 179 DGYWKWFAGNLASGGA 194 Score = 31.1 bits (67), Expect = 0.42 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 363 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 Score = 28.7 bits (61), Expect = 2.2 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 429 +++ G+VD + + K G+ +RG + + + L F D K V L G Sbjct: 227 RQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLTG 280 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 75.8 bits (178), Expect = 1e-14 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 YKGI D F R K++G S WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 124 YKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLF 172 Score = 53.6 bits (123), Expect = 7e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 FA DFL GG+SAAVSKTA APIERVKLL+Q Q Sbjct: 80 FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQ 111 Score = 33.9 bits (74), Expect = 0.059 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 441 DAFWRYFAGNLASGGA 488 D +W++FAGNLASGGA Sbjct: 179 DGYWKWFAGNLASGGA 194 Score = 31.1 bits (67), Expect = 0.42 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 363 +YK +DAF +I K +G S ++G AN++R Sbjct: 323 KYKSSLDAFKQILKNEGAKSLFKGAGANILR 353 Score = 28.7 bits (61), Expect = 2.2 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 429 +++ G+VD + + K G+ +RG + + + L F D K V L G Sbjct: 227 RQFDGLVDVYRKTLKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLTG 280 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 71.3 bits (167), Expect = 3e-13 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 417 Y G+ + F RI +E+G+LSFWRGN ANVIRYFPTQA NFAFK +K + Sbjct: 54 YTGLGNCFTRIYREEGVLSFWRGNQANVIRYFPTQASNFAFKGYFKNL 101 Score = 44.8 bits (101), Expect = 3e-05 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 F+ DF+ GG +A V+K+A APIERVKLLLQ Q Sbjct: 10 FSADFVMGGAAAIVAKSAAAPIERVKLLLQNQ 41 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/63 (19%), Positives = 31/63 (49%) Frame = +1 Query: 241 ARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 A++ ++ +++KG++D + + G+ +RG +++ + + F D K + Sbjct: 147 AKECSVNGKRQFKGMIDVYRKTLSSDGIKGLYRGFGVSIVGITLYRGMYFGMYDTIKPIV 206 Query: 421 LGG 429 L G Sbjct: 207 LVG 209 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 66.1 bits (154), Expect = 1e-11 Identities = 26/63 (41%), Positives = 42/63 (66%) Frame = +1 Query: 259 AADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 438 A +R+KG+ D R +E+G+LS WRGN ++V+RY+P+ ALNF+ KD Y+ + + Sbjct: 74 AGKRRFKGMFDFIFRTVREEGVLSLWRGNGSSVLRYYPSVALNFSLKDLYRSILRNSSSQ 133 Query: 439 KTH 447 + H Sbjct: 134 ENH 136 Score = 41.5 bits (93), Expect = 3e-04 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 F KD LAG + V T VAPIER KLLLQ Q Sbjct: 30 FQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQ 61 Score = 32.3 bits (70), Expect = 0.18 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF-LGGV 432 Y+ +D + +I + +GL SF+RG +N+ R + A+ F D+ K+ GG+ Sbjct: 278 YRSTLDCWKKIYRSEGLASFYRGALSNMFRSTGSAAI-LVFYDEVKRFLNWGGI 330 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 46.0 bits (104), Expect = 1e-05 Identities = 17/32 (53%), Positives = 27/32 (84%) Frame = +2 Query: 146 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 FAK+ +AGG++ ++KTAVAP+ER+K+L Q + Sbjct: 17 FAKELIAGGVTGGIAKTAVAPLERIKILFQTR 48 Score = 43.2 bits (97), Expect = 1e-04 Identities = 21/63 (33%), Positives = 36/63 (57%) Frame = +1 Query: 280 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHSGVT 459 G+V + +I K +GL+ F+RGN A+V R P AL++ ++Y++ + G T + Sbjct: 56 GLVGSINKIGKTEGLMGFYRGNGASVARIVPYAALHYMAYEEYRRWIIFGFPDTTRGPLL 115 Query: 460 SLV 468 LV Sbjct: 116 DLV 118 Score = 36.3 bits (80), Expect = 0.011 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 250 QAIAADQR-YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 +AI +Q Y+GIVD F R +E G +RG ++ FP L F F ++ K+ Sbjct: 148 KAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAGLKFYFYEEMKR 203 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 46.0 bits (104), Expect = 1e-05 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +1 Query: 280 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 438 G ++A I KE+G+ +W+GN VIR P A+ + YK +F G D+ Sbjct: 132 GFIEAITLIAKEEGVKGYWKGNLPQVIRVLPYSAVQLLAYESYKNLFKGKDDQ 184 Score = 35.9 bits (79), Expect = 0.015 Identities = 17/46 (36%), Positives = 28/46 (60%) Frame = +2 Query: 110 SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHV 247 +N ++ LA A F AG ++ A +KT AP++R+KLL+Q + Sbjct: 75 NNPLAILALVPKDAAIFAAGALAGAAAKTVTAPLDRIKLLMQTHGI 120 Score = 34.3 bits (75), Expect = 0.045 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +1 Query: 238 TARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 417 T R+Q YK I +AF I GL+ +RG N ++ P ++ D K++ Sbjct: 300 TVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLPNALKTLPNSSIRLTTFDMVKRL 359 Score = 31.9 bits (69), Expect = 0.24 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = +1 Query: 256 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVD 435 +A + RY+ + + + +++G+ SF+ G +++ P A+NF D K+ Sbjct: 215 LAVEPRYRTMSQVALSMLRDEGIASFYYGLGPSLVGIAPYIAVNFCIFDLVKKSLPEEYR 274 Query: 436 KKTHSGVTSLVI 471 KK S + + V+ Sbjct: 275 KKAQSSLLTAVL 286 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 45.6 bits (103), Expect = 2e-05 Identities = 19/34 (55%), Positives = 27/34 (79%) Frame = +2 Query: 143 AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQH 244 + K AGG++ VS+TAVAP+ER+K+LLQVQ+ Sbjct: 37 SICKSLFAGGVAGGVSRTAVAPLERMKILLQVQN 70 Score = 32.3 bits (70), Expect = 0.18 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +1 Query: 250 QAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 411 Q + +Y+GI A + +E+G + +RG +VI P LNF+ + K Sbjct: 172 QTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSVYESLK 225 Score = 32.3 bits (70), Expect = 0.18 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +1 Query: 262 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 417 A Y G+VDAF + + +G + ++G N ++ P+ A+ F + K V Sbjct: 292 ASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDV 343 Score = 29.9 bits (64), Expect = 0.96 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 390 +Y G V I + +GL ++GN N R P A+ F Sbjct: 75 KYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKF 114 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 44.8 bits (101), Expect = 3e-05 Identities = 22/47 (46%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +2 Query: 104 T*SNKMSNLADPV-AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 T S + +L D + AK +AGG + A++KTAVAP+ER+K+LLQ + Sbjct: 8 TLSADVMSLVDTLPVLAKTLIAGGAAGAIAKTAVAPLERIKILLQTR 54 Score = 32.7 bits (71), Expect = 0.14 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 265 DQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 D + G+ + ++ + G L F++GN A+VIR P AL++ + Y+ L Sbjct: 57 DFKTLGVSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAALHYMTYEVYRDWIL 109 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 44.4 bits (100), Expect = 4e-05 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = +1 Query: 280 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 426 G ++A I KE+G+ +W+GN VIR P A+ + YK++F G Sbjct: 160 GFIEAITLIGKEEGIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRG 208 Score = 33.5 bits (73), Expect = 0.078 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 158 FLAGGISAAVSKTAVAPIERVKLLLQVQHV 247 F AG + A +K+ AP++R+KLL+Q V Sbjct: 119 FFAGAFAGAAAKSVTAPLDRIKLLMQTHGV 148 Score = 33.5 bits (73), Expect = 0.078 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +1 Query: 238 TARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 417 T R+Q YK ++DAF I +G++ +RG N ++ P ++ D K++ Sbjct: 328 TIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIVKKL 387 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = +1 Query: 256 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVD 435 +A + Y+ + + + +E+G+ SF+ G +++ P A+NF D K+ Sbjct: 243 LAVEPGYRTMSQVALNMLREEGVASFYNGLGPSLLSIAPYIAINFCVFDLVKKSLPEKYQ 302 Query: 436 KKTHSGVTSLVI 471 +KT S + + V+ Sbjct: 303 QKTQSSLLTAVV 314 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 42.7 bits (96), Expect = 1e-04 Identities = 24/71 (33%), Positives = 36/71 (50%) Frame = +1 Query: 223 AAAPSTARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKD 402 A AP + A+ + G+V +I +E LL F+RGN NV + P A+ FA + Sbjct: 221 ATAPLDRLKVALQVQRTNLGVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIKFAAYE 280 Query: 403 KYKQVFLGGVD 435 K + +GG D Sbjct: 281 MLKPI-IGGAD 290 Score = 42.3 bits (95), Expect = 2e-04 Identities = 19/34 (55%), Positives = 27/34 (79%) Frame = +2 Query: 149 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 250 +K LAGGI+ AVS+TA AP++R+K+ LQVQ + Sbjct: 205 SKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTN 238 Score = 30.7 bits (66), Expect = 0.55 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +2 Query: 161 LAGGISAAVSKTAVAPIERVKLLLQ 235 LAGG++ AV++TA+ P++ VK LQ Sbjct: 300 LAGGLAGAVAQTAIYPMDLVKTRLQ 324 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/51 (23%), Positives = 26/51 (50%) Frame = +1 Query: 262 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 AD + F++ + +GL F+RG F N + P+ ++++ + K+ Sbjct: 423 ADSSKTSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKK 473 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 42.7 bits (96), Expect = 1e-04 Identities = 17/28 (60%), Positives = 25/28 (89%) Frame = +2 Query: 158 FLAGGISAAVSKTAVAPIERVKLLLQVQ 241 F+AGGI+ A S+TA AP++R+K+LLQ+Q Sbjct: 212 FIAGGIAGAASRTATAPLDRLKVLLQIQ 239 Score = 30.3 bits (65), Expect = 0.73 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +1 Query: 223 AAAPSTARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKD 402 A AP + + + I +A I K+ G+ F+RGN N+++ P A+ F + Sbjct: 225 ATAPLDRLKVLLQIQKTDARIREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKFYAYE 284 Query: 403 KYK 411 +K Sbjct: 285 LFK 287 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 42.7 bits (96), Expect = 1e-04 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 429 + YK +VDA RI +++G+ S WRG++ V R A A D K++ + G Sbjct: 187 RNYKSVVDAIDRIARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAG 240 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 42.3 bits (95), Expect = 2e-04 Identities = 20/78 (25%), Positives = 41/78 (52%) Frame = +1 Query: 253 AIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGV 432 ++ +D +YKG +D F +I +++G WRG A++ PT + D ++ + + Sbjct: 93 SVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASLTLAIPTVGIYMPCYDYFRNI----M 148 Query: 433 DKKTHSGVTSLVIWPPVV 486 ++ T SL ++ P+V Sbjct: 149 EEFTTEKSPSLTVYVPLV 166 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 41.9 bits (94), Expect = 2e-04 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = +1 Query: 304 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 I QGL FW+GN NV+R P +A+NF D Y++ L Sbjct: 92 IATTQGLTGFWKGNLLNVLRTAPFKAVNFCAYDTYRKQLL 131 Score = 31.9 bits (69), Expect = 0.24 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 152 KDFLAGGISAAVSKTAVAPIERVKL 226 K AG ++A VSKT +AP+ER+KL Sbjct: 50 KHLWAGAVAAMVSKTFLAPLERLKL 74 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 41.1 bits (92), Expect = 4e-04 Identities = 17/27 (62%), Positives = 25/27 (92%) Frame = +2 Query: 161 LAGGISAAVSKTAVAPIERVKLLLQVQ 241 LAGG++ AVS+TA AP++R+K++LQVQ Sbjct: 210 LAGGLAGAVSRTATAPLDRLKVVLQVQ 236 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/25 (44%), Positives = 20/25 (80%) Frame = +2 Query: 161 LAGGISAAVSKTAVAPIERVKLLLQ 235 +AGG++ A+++TA+ P++ VK LQ Sbjct: 301 MAGGMAGALAQTAIYPMDLVKTRLQ 325 Score = 27.1 bits (57), Expect = 6.8 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +1 Query: 262 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 AD + F+ K +GL F+RG N+++ P ++ + + K+ Sbjct: 424 ADSSKTTMKQEFMNTMKGEGLRGFYRGLLPNLLKVVPAASITYIVYEAMKK 474 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 40.3 bits (90), Expect = 7e-04 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 405 RYKG+V A I E+GL++ WRG ++R P QA+ +A D+ Sbjct: 250 RYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPPGQAIMWAVADQ 294 Score = 30.3 bits (65), Expect = 0.73 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKY 408 +YKG + I +E+ +L W G V+R QA+ F K+ + Sbjct: 148 KYKGPIHCARTIVREESILGLWSGAAPTVMRNGTNQAVMFTAKNAF 193 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 39.9 bits (89), Expect = 9e-04 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +1 Query: 283 IVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 411 +++ RI +G+ FW+GN N++R P +++NF D Y+ Sbjct: 168 LLELIQRIATNEGIRGFWKGNLVNILRTAPFKSINFYAYDTYR 210 Score = 31.5 bits (68), Expect = 0.32 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 125 NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKL 226 N A + K AG +A VS+T +AP+ER+KL Sbjct: 124 NGAGALNTTKHLWAGAFAAMVSRTCIAPLERMKL 157 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = +1 Query: 256 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVD 435 ++ +Y G+V A I +E+G FWRGN ++ P ++ F K K G Sbjct: 63 LSGASKYTGMVQATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTK 122 Query: 436 KKTH 447 + H Sbjct: 123 TEDH 126 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +1 Query: 259 AADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDK 438 AA R I+ RI E+GL +FW+GN + P ++NF + YK+ Sbjct: 71 AAALRKPSILHEASRILNEEGLKAFWKGNLVTIAHRLPYSSVNFYAYEHYKKFMYMVTGM 130 Query: 439 KTH-SGVTS 462 + H G++S Sbjct: 131 ENHKEGISS 139 Score = 37.1 bits (82), Expect = 0.006 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +2 Query: 149 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 A LAGG++ A SKT AP+ R+ +L QVQ Sbjct: 35 ASQLLAGGLAGAFSKTCTAPLSRLTILFQVQ 65 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +1 Query: 301 RIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHSGVTS 462 RI E+G +FW+GN V+ P A+NF +KY F ++ G TS Sbjct: 92 RIINEEGYRAFWKGNLVTVVHRIPYTAVNFYAYEKYNLFFNSNPVVQSFIGNTS 145 Score = 37.1 bits (82), Expect = 0.006 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = +2 Query: 152 KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 ++ LAGGI+ A+SKT AP+ R+ +L Q+Q Sbjct: 43 QNLLAGGIAGAISKTCTAPLARLTILFQLQ 72 Score = 33.9 bits (74), Expect = 0.059 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 411 Y+GI F I +E+G+L ++G A ++ P+ A+NFA + K Sbjct: 185 YQGIEHTFRTICREEGILGLYKGLGATLLGVGPSLAINFAAYESMK 230 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 161 LAGGISAAVSKTAVAPIERVKLLLQVQ 241 ++GG++ AVS TA P++ V+ +QV+ Sbjct: 248 VSGGLAGAVSSTATYPLDLVRRRMQVE 274 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 301 RIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 411 RI KE+G +FW+GN V P A+NF ++YK Sbjct: 120 RIVKEEGFRAFWKGNLVTVAHRLPYGAVNFYAYEEYK 156 Score = 35.5 bits (78), Expect = 0.019 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 161 LAGGISAAVSKTAVAPIERVKLLLQVQ 241 LAGGI+ A SKT AP+ R+ +L Q+Q Sbjct: 74 LAGGIAGAFSKTCTAPLARLTILFQIQ 100 Score = 35.1 bits (77), Expect = 0.026 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 Y+G+ AF I +E+G+L ++G A ++ P+ A++FA + +K +L Sbjct: 213 YQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISFAAYETFKTFWL 262 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHS 450 +Y G+ I +E+GL FWRGN ++ P ++ FA K K G + H+ Sbjct: 63 KYNGLFRTTKDIFREEGLSGFWRGNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAENHA 122 Score = 30.3 bits (65), Expect = 0.73 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 155 DFLAGGISAAVSKTAVAPIERVKLLLQVQ 241 D AGG++ A+S+ +P++ +K+ QVQ Sbjct: 18 DASAGGVAGAISRMVTSPLDVIKIRFQVQ 46 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHSG 453 YKGI DAF++I +E+G +RG ++I P A N+ D ++ + ++ Sbjct: 239 YKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAATNYFAYDSLRKAYRSFSKQEKIGN 298 Query: 454 VTSLVI 471 + +L+I Sbjct: 299 IETLLI 304 Score = 31.1 bits (67), Expect = 0.42 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 289 DAFVRIPKEQGLLSFWRGNFANVIRYFPTQALN-FAFKDKYKQV 417 + F I K +G +RGN NVIR P +A+ F F+ K++ Sbjct: 149 EVFSDIMKHEGWTGLFRGNLVNVIRVAPARAVELFVFETVNKKL 192 Score = 29.9 bits (64), Expect = 0.96 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 161 LAGGISAAVSKTAVAPIERVKLLLQV 238 L+G ++ AVS+T VAP+E ++ L V Sbjct: 115 LSGAVAGAVSRTVVAPLETIRTHLMV 140 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/57 (21%), Positives = 31/57 (54%) Frame = +1 Query: 253 AIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 A++ YK ++ A V I + +G+L +++G + ++ P ++F + K++ + Sbjct: 330 AVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLKLVPAAGISFMCYEACKKILI 386 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 36.3 bits (80), Expect = 0.011 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = +1 Query: 244 RQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 390 R Q + +YKG +DA +I +++G F+RG+ V+ Y P AL F Sbjct: 278 RLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWYLPASALTF 326 Score = 27.5 bits (58), Expect = 5.1 Identities = 19/65 (29%), Positives = 27/65 (41%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHSG 453 Y G+ A I KEQG + G ++ + R P L F + K + G K G Sbjct: 188 YTGMFQAGCSIWKEQGPKGLYAGYWSTLARDVPFAGLMVVFYEGLKDLTDQGKKKFPQYG 247 Query: 454 VTSLV 468 V S + Sbjct: 248 VNSSI 252 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 35.9 bits (79), Expect = 0.015 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 253 AIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 A A +RY G ++A+ I +++G+ + W G NV R A A D+ K+ L Sbjct: 149 AAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETIL 205 Score = 30.7 bits (66), Expect = 0.55 Identities = 15/66 (22%), Positives = 29/66 (43%) Frame = +1 Query: 217 CQAAAPSTARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAF 396 C + + + + YKG +D FV+ K G ++F++G N R + F Sbjct: 230 CIGSPVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNFGRLGSWNVIMFLT 289 Query: 397 KDKYKQ 414 ++ K+ Sbjct: 290 LEQAKK 295 Score = 30.3 bits (65), Expect = 0.73 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +1 Query: 244 RQQAIAAD---QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 ++ A+A D +Y+G++ I +E+GL S W+G + R L + K Sbjct: 42 QKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFGGLRIGMYEPVKN 101 Query: 415 VFLG 426 +++G Sbjct: 102 LYVG 105 >At4g27940.1 68417.m04009 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 413 Score = 35.5 bits (78), Expect = 0.019 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 411 +YKG D F +I +++GL WRG A + P + F D ++ Sbjct: 145 QYKGTFDVFTKIIRQEGLGRLWRGTNAGLALAVPMVGIYLPFYDMFR 191 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 35.1 bits (77), Expect = 0.026 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 +RY G VDA+ I K +G+ + W G N+ R A A D+ K+ + Sbjct: 156 RRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIM 207 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 426 +Y+G + I +E+G+ W+G A + R L + K + +G Sbjct: 56 KYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVG 107 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.1 bits (77), Expect = 0.026 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 +RY G VDA+ I K +G+ + W G N+ R A A D+ K+ + Sbjct: 156 RRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIM 207 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 426 +Y+G + I +E+G+ W+G A + R L + K + +G Sbjct: 56 KYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVG 107 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 35.1 bits (77), Expect = 0.026 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 277 KGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 384 + I +F+ + ++QG W GN N+IR PTQA+ Sbjct: 83 RSIPGSFLEVVQKQGWQGLWAGNEINMIRIIPTQAI 118 Score = 29.1 bits (62), Expect = 1.7 Identities = 9/25 (36%), Positives = 20/25 (80%) Frame = +2 Query: 149 AKDFLAGGISAAVSKTAVAPIERVK 223 A++FL+G ++ A++K +AP+E ++ Sbjct: 49 AREFLSGALAGAMTKAVLAPLETIR 73 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 35.1 bits (77), Expect = 0.026 Identities = 14/62 (22%), Positives = 32/62 (51%) Frame = +1 Query: 262 ADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKK 441 A+ +Y G++D ++ + +G+ +RG N++R P+ + F + + F V + Sbjct: 254 AETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVPPE 313 Query: 442 TH 447 T+ Sbjct: 314 TN 315 Score = 30.7 bits (66), Expect = 0.55 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 250 QAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 417 +A A+ QR I+ + I KE+G +RG +I P A+ F+ K K V Sbjct: 52 EAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAVYFSVYGKLKDV 107 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 34.7 bits (76), Expect = 0.034 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 256 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 +A + Y G+ DA + K +G+ S WRG+ + R A A D++K+ L Sbjct: 162 LAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMIVTAAQLASYDQFKEGIL 217 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 33.9 bits (74), Expect = 0.059 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 +YK I F + KEQG+ F+RG ++ Y A F F + +K+ + Sbjct: 112 KYKSISSGFGILLKEQGVKGFFRGWVPTLLGYSAQGACKFGFYEYFKKTY 161 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 33.5 bits (73), Expect = 0.078 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +1 Query: 244 RQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 390 ++Q +++RY G+ D ++ ++ G F+RG N++R P + F Sbjct: 242 QEQGHHSEKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITF 290 >At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) identical to 36kDa-peroxisomal membrane protein (PMP36) GI:15146342 from [Arabidopsis thaliana] Length = 331 Score = 33.5 bits (73), Expect = 0.078 Identities = 13/46 (28%), Positives = 28/46 (60%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 405 Q+YKG +DA +++ + +GL F++G +++ A+ F K++ Sbjct: 271 QQYKGTLDAILKMIRYEGLYGFYKGMSTKIVQSVLAAAVLFMIKEE 316 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +1 Query: 229 APSTARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 360 +PS+ + +A + R G + + E G+ FW+G +I Sbjct: 155 SPSSNAEALVAVEPRPYGTFNTIREVYDEAGITGFWKGVIPTLI 198 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 33.5 bits (73), Expect = 0.078 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKK 441 RY G ++AF +I + +G+ W+G N+ R F A D K +DKK Sbjct: 156 RYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGELACYDHAKHFV---IDKK 209 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 33.1 bits (72), Expect = 0.10 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 268 QRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 423 + YK ++DA ++ + +G+ S WRG+ + R + A D K+ L Sbjct: 159 RNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASYDSVKETIL 210 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 31.5 bits (68), Expect = 0.32 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Frame = +2 Query: 11 ISCSKIRS*CFVIPHPRVPQLPPRHIHLVKIT*SNKMSNLADPVA-FAKDFLAGGISAAV 187 IS R+ ++P+ R+ Q PR+I T +A P K LAGG+++A+ Sbjct: 496 ISYGHFRNFMVLLPYERL-QDDPRNIWFEAATVVAVAPPVALPAGDVLKSALAGGLASAL 554 Query: 188 SKTAVAPIERVKLLLQVQHVS 250 S + + PI+ +K +Q +S Sbjct: 555 STSLMHPIDTIKTRVQASTLS 575 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 30.7 bits (66), Expect = 0.55 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 277 KGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA-FKDKYKQVFLGGVDKK 441 KG++D F R+ + +GL F RG F R P + F+ F+ + ++ + K+ Sbjct: 147 KGLLDGFPRVYRSEGLAGFHRGLFPLWCRNLPFSMVMFSTFEQSVEFIYQKIIQKR 202 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 30.7 bits (66), Expect = 0.55 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 274 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 393 Y+GI D F + K++G WRG V R F FA Sbjct: 235 YEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFA 274 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 30.7 bits (66), Expect = 0.55 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTHS 450 +YKG+ D I +E+G + W+G V+ ++ F +K KQ+ L +K+H+ Sbjct: 268 QYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQI-LSERSQKSHN 326 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 30.7 bits (66), Expect = 0.55 Identities = 15/57 (26%), Positives = 30/57 (52%) Frame = +1 Query: 244 RQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 +Q+ + YKG+ D R+ +E+G+ +F+ V+ P A++FA + K+ Sbjct: 155 KQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAAKK 211 >At4g22590.1 68417.m03259 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPA) GI:2944178; contains Pfam profile PF02358: Trehalose-phosphatase Length = 377 Score = 30.3 bits (65), Expect = 0.73 Identities = 22/81 (27%), Positives = 36/81 (44%) Frame = +1 Query: 241 ARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 A+ + IA Y G + V P + R +V +YFPT ++ +DK Q Sbjct: 103 AKNKKIAVFLDYDGTLSPIVDDPDRAIMSDAMRAAVKDVAKYFPTAIISGRSRDKVYQ-- 160 Query: 421 LGGVDKKTHSGVTSLVIWPPV 483 L G+ + ++G + I PV Sbjct: 161 LVGLTELYYAGSHGMDIMTPV 181 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 30.3 bits (65), Expect = 0.73 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 116 KMSNLADPVA-FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSK 253 K NL P + F GIS A++ P++ VK+ LQ+QHV + Sbjct: 52 KPQNLIPPFSKVVSHFGISGISVALATGVTHPLDVVKVRLQMQHVGQ 98 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 30.3 bits (65), Expect = 0.73 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 420 +YK I AF KEQGL F RG ++ Y A + + K+ + Sbjct: 101 KYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYY 150 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 29.9 bits (64), Expect = 0.96 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +1 Query: 256 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 +A + Y A RI ++G+L+ W+G V+R ALN Y Q Sbjct: 141 LAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVR---AMALNMGMLASYDQ 190 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = +1 Query: 244 RQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 414 +Q+ + YKG+ D R+ +E+G +F+ V+ P A++F + K+ Sbjct: 157 KQRLQIGNGTYKGVWDCIKRVTREEGFGAFYASYRTTVLMNAPFTAVHFTTYEAVKR 213 Score = 27.9 bits (59), Expect = 3.9 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 280 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 429 GI AF I K G + +RG +A + P A+ F+F + K+ GG Sbjct: 78 GIRQAFRSIIKTDGPSALYRGIWAMGLGAGPAHAVYFSFYEVSKKFLSGG 127 >At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 235 STARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 405 S A+ + IA Y G + V P + S R NV +YFPT ++ +DK Sbjct: 114 SFAKGKRIALFLDYDGTLSPIVEEPDCAYMSSAMRSAVQNVAKYFPTAIISGRSRDK 170 >At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 384 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 235 STARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 405 S A+ + IA Y G + V P + S R NV +YFPT ++ +DK Sbjct: 113 SFAKGKRIALFLDYDGTLSPIVEEPDCAYMSSAMRSAVQNVAKYFPTAIISGRSRDK 169 >At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +1 Query: 235 STARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDK 405 S A+ + IA Y G + V P + S R NV +YFPT ++ +DK Sbjct: 114 SFAKGKRIALFLDYDGTLSPIVEEPDCAYMSSAMRSAVQNVAKYFPTAIISGRSRDK 170 >At4g39460.1 68417.m05583 mitochondrial substrate carrier family protein Length = 325 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 158 FLAGGISAAVSKTAVAPIERVKLLLQ 235 F+AGG + V +TA+ PI+ +K LQ Sbjct: 58 FIAGGTAGVVVETALYPIDTIKTRLQ 83 >At4g18600.1 68417.m02755 expressed protein Length = 1907 Score = 28.7 bits (61), Expect = 2.2 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -1 Query: 473 QITSEVTPECVFLSTPPRNTCLYLSLKAKLSAWVGKYLMTLAKLPRQ 333 Q EV PE FL P TCL L+++ LS + +L++LP + Sbjct: 843 QCLVEVAPEERFLPEEPVITCLSLTMEGVLSEKSPETYPSLSELPEE 889 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 390 RY G +DAF +I K +G+ ++G + R P A F Sbjct: 250 RYTGSMDAFRKILKSEGVKGLYKGFGPAMARSVPANAACF 289 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 28.3 bits (60), Expect = 2.9 Identities = 25/71 (35%), Positives = 36/71 (50%) Frame = -2 Query: 466 PAK*RQNASSCQRRRGTPACTCP*RRS*APGSGST**RWRSYHARMKGDPAPWGCGRRRR 287 P++ R++ S RRR +P + P RR +P + R + AR + P+P RR Sbjct: 306 PSRRRRSPSPPARRRRSP--SPPARRRRSPSPPARRHRSPTPPARQRRSPSP---PARRH 360 Query: 286 RYPCNAGRRRS 254 R P A RRRS Sbjct: 361 RSPPPARRRRS 371 Score = 28.3 bits (60), Expect = 2.9 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = -2 Query: 466 PAK*RQNASSCQRRRGTPACTCP*RRS*APGSGST**RWRSYH-ARMKGDPAPWGCGRRR 290 PA+ R++ S RR +P RRS +P + R RS AR + P+P RR Sbjct: 326 PARRRRSPSPPARRHRSPTPPARQRRSPSPPAR----RHRSPPPARRRRSPSP---PARR 378 Query: 289 RRYPCNAGRRRSLADVLY 236 RR P RRR LY Sbjct: 379 RRSPSPPARRRRSPSPLY 396 >At5g26200.1 68418.m03118 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 27.9 bits (59), Expect = 3.9 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 271 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 393 RY+ DAF +I G F+RG +++ Y P+ A+ +A Sbjct: 181 RYRNGFDAFRKILYTDGPRGFYRGFGISILTYAPSNAVWWA 221 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 27.9 bits (59), Expect = 3.9 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 6 SKSPVQKSGVSVS*SPIRVCRNS 74 S+SPV+ S SVS SPIR+ R S Sbjct: 596 SRSPVRSSRKSVSRSPIRLSRRS 618 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 247 QQAIAADQRYKGIVDAFVRIPKEQGLLSFWRG 342 Q + Q Y G++DAF I KE+G + ++G Sbjct: 137 QTPLHQTQPYSGLLDAFRTIVKEEGPRALYKG 168 >At1g71680.1 68414.m08271 lysine and histidine specific transporter, putative similar to lysine and histidine specific transporter GB: AAC49885 GI:2576361 from (Arabidopsis thaliana); contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 434 Score = 27.5 bits (58), Expect = 5.1 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = -1 Query: 449 ECVFLSTPPRNTCLYLSLKAKLSAWVGKYLMTLAKLPRQNERRPCSLGMR 300 + V +P N+ +SL A L +++ + ++A + + E RP + G+R Sbjct: 172 QLVLSQSPDFNSIKIVSLLAALMSFLYSMIASVASIAKGTEHRPSTYGVR 221 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 27.1 bits (57), Expect = 6.8 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 Query: 250 QAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQA 381 Q + Y G +D +I K G+ +RG +V+ Y P+ A Sbjct: 156 QGYSGHATYTGGIDVATKIIKSYGVRGLYRGFGLSVMTYSPSSA 199 >At2g34720.1 68415.m04264 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 198 Score = 27.1 bits (57), Expect = 6.8 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 294 LRPHPQGAGSPFILAW*LRQRHQVLPDPGAQLRLQGQVQAGVP 422 L P+P P+ + +Q + P PG QL+L G Q GVP Sbjct: 52 LYPYPD----PYYRSVFAQQAYLPHPYPGVQLQLMGMQQPGVP 90 >At4g12430.1 68417.m01967 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis thaliana] GI:2944180; contains Pfam profile PF02358: Trehalose-phosphatase Length = 368 Score = 26.6 bits (56), Expect = 9.0 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +1 Query: 241 ARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 417 A+++ IA Y G + V P + R +V YFPT ++ +DK Q+ Sbjct: 100 AKKKKIAVFLDYDGTLSPIVDDPDRAIMSDAMRSAVKDVASYFPTAIISGRSRDKVYQL 158 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 26.6 bits (56), Expect = 9.0 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +1 Query: 232 PSTARQQAIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 411 P +Q + A+Q + IV+A V ++GL +RG ++R P ++ K Sbjct: 137 PCEVLKQRLQANQ-FDNIVEATVSTWHQEGLKGLFRGTGVTLLREVPFYVAGMGLYNQSK 195 Query: 412 QV 417 +V Sbjct: 196 KV 197 >At2g17090.1 68415.m01973 protein kinase family protein similar to Arabidopsis thaliana APK1A [SP|Q06548], APK1B [SP|P46573]; contains Pfam profile: PF00069 Protein kinase domain Length = 465 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 61 CAATPTSTYSPSEDHIIEQNVEPRRSG 141 C + +ST P +DH + + EPR G Sbjct: 3 CCYSLSSTVDPVQDHTTDASSEPRNGG 29 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +1 Query: 289 DAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGV 432 DAF +I + G +RG +++ Y P+ A+ +A +++ GG+ Sbjct: 174 DAFRKIVRADGPKGLYRGFGISILTYAPSNAVWWASYSVAQRMVWGGI 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,243,463 Number of Sequences: 28952 Number of extensions: 198021 Number of successful extensions: 723 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -