BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20662 (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 6e-18 SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) 44 2e-04 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 43 3e-04 SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) 43 3e-04 SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014) 42 4e-04 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) 42 7e-04 SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.002 SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) 39 0.005 SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) 38 0.012 SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) 37 0.020 SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) 37 0.020 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 36 0.027 SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) 36 0.027 SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 35 0.083 SB_21443| Best HMM Match : Mito_carr (HMM E-Value=2.8e-26) 34 0.11 SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) 34 0.11 SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) 34 0.14 SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) 32 0.58 SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.77 SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05) 31 0.77 SB_9806| Best HMM Match : Mito_carr (HMM E-Value=0.061) 31 0.77 SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.77 SB_189| Best HMM Match : Peptidase_A17 (HMM E-Value=1.9e-35) 31 0.77 SB_16027| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) 31 1.0 SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) 31 1.0 SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21) 30 2.3 SB_23920| Best HMM Match : Mito_carr (HMM E-Value=0.00039) 30 2.3 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 3.1 SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) 29 3.1 SB_45406| Best HMM Match : 7tm_2 (HMM E-Value=5.9) 29 4.1 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 29 5.4 SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) 29 5.4 SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_3432| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-28) 28 7.2 SB_45532| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-40) 28 7.2 SB_43929| Best HMM Match : TLE_N (HMM E-Value=0.49) 28 9.5 SB_32253| Best HMM Match : Mito_carr (HMM E-Value=1.6e-31) 28 9.5 SB_26302| Best HMM Match : Reg_prop (HMM E-Value=3.1e-06) 28 9.5 SB_6969| Best HMM Match : Astacin (HMM E-Value=0) 28 9.5 SB_3306| Best HMM Match : DUF837 (HMM E-Value=0.71) 28 9.5 SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 88.2 bits (209), Expect = 6e-18 Identities = 42/75 (56%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Frame = +1 Query: 511 FVYPLDFARTRLAAD--VGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIY 684 FVY LD+ RTRLA D VGK G+R+F+G+ + K SDGL+GLYRGF +S GII+Y Sbjct: 130 FVYSLDYCRTRLANDAKVGKKGGERQFNGMIDVYKKTIASDGLVGLYRGFVISCVGIIVY 189 Query: 685 RASYFGFYDTARGML 729 R YFG YDT + +L Sbjct: 190 RGFYFGLYDTLKPIL 204 Score = 77.8 bits (183), Expect = 9e-15 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = +2 Query: 266 DQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 421 D YKG++D R + +G LSFWRGN AN IRYFPTQALNFAFKD+ K +F Sbjct: 50 DHPYKGVIDCTSRTYRSEGFLSFWRGNLANCIRYFPTQALNFAFKDQVKALF 101 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +3 Query: 147 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 242 F ++F G +A +SKTA APIERVKLL+Q Q Sbjct: 9 FVENFGLSGAAAIISKTAAAPIERVKLLVQNQ 40 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/51 (31%), Positives = 32/51 (62%) Frame = +2 Query: 272 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 424 +YKG +D ++I K++G +S +G AN++R + F DK+K++++ Sbjct: 248 KYKGSIDCTIQILKKEGAMSLMKGAGANILRGMAGAGVLAGF-DKFKELYV 297 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +1 Query: 583 FSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGMLPDPKNT 747 + G+ +C S+ ++S+G + +RG + +A F F D + + PK T Sbjct: 53 YKGVIDCTSRTYRSEGFLSFWRGNLANCIRYFPTQALNFAFKDQVKALF-KPKKT 106 >SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 52.4 bits (120), Expect = 4e-07 Identities = 20/48 (41%), Positives = 35/48 (72%) Frame = +2 Query: 272 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 415 ++KG++ ++I KE+G+L +++GN NVIR FP A+ FA ++YK+ Sbjct: 70 KFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKK 117 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +3 Query: 153 KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 242 K LAGGI+ AVS+T+V+P+ERVK+LLQ+Q Sbjct: 36 KHLLAGGIAGAVSRTSVSPLERVKILLQIQ 65 >SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) Length = 95 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/68 (33%), Positives = 38/68 (55%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 YPLD R RLA K +++GL N ++I++ +G+ YRG+ ++ GI+ Y Sbjct: 8 YPLDMVRARLAITQKK-----KYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGIS 62 Query: 697 FGFYDTAR 720 F Y+T + Sbjct: 63 FFTYETCK 70 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/55 (29%), Positives = 32/55 (58%) Frame = +2 Query: 257 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 421 I ++Y G+++AF RI +++G+ +F+RG +I P ++F + K+ F Sbjct: 19 ITQKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCKKAF 73 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/74 (28%), Positives = 37/74 (50%) Frame = +1 Query: 514 VYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRAS 693 VYP+D +TR+ + ++ + +C K+ +++G IGLYRG + G+ +A Sbjct: 931 VYPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLPQLLGVSPEKAI 990 Query: 694 YFGFYDTARGMLPD 735 D RG+ D Sbjct: 991 KLTTNDFVRGIFSD 1004 Score = 32.3 bits (70), Expect = 0.44 Identities = 12/55 (21%), Positives = 28/55 (50%) Frame = +2 Query: 257 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 421 + A++ YK +D F ++ + +G + +RG ++ P +A+ D + +F Sbjct: 948 LEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLPQLLGVSPEKAIKLTTNDFVRGIF 1002 >SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 313 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQRE-FSGLGNCISKIFKSDGLIGLYRGFGVSVQGII-IYRA 690 +PLD + RL G++ F+G +C K +++G GLY+G + G+ I+ Sbjct: 45 HPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGLYKGMAAPITGVTPIFAI 104 Query: 691 SYFGFYDTARGMLPDPKNTP 750 ++GF + + DP P Sbjct: 105 CFWGFNMGKKLQMKDPNADP 124 >SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014) Length = 76 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = +3 Query: 120 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 242 MS + F ++F G +A +SKTA APIERVKLL+Q Q Sbjct: 1 MSGKKQNLHFVENFALSGAAAIISKTAAAPIERVKLLVQNQ 41 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWR 340 YKG+VD +R + +G+ SFWR Sbjct: 54 YKGVVDCTMRTYRAEGIGSFWR 75 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/65 (38%), Positives = 36/65 (55%) Frame = +2 Query: 248 QQEIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 427 Q + ++ R+ GIV F + +E G+ S WRGN ANVI+ P + F +K K+ L Sbjct: 165 QVQASSTNRF-GIVSGFKMMLREGGIKSLWRGNGANVIKIAPESGIKFFAYEKAKK--LV 221 Query: 428 GVDKK 442 G D K Sbjct: 222 GSDTK 226 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/69 (34%), Positives = 37/69 (53%) Frame = +1 Query: 514 VYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRAS 693 +YPL+ +TRLA + GQ + GL + S I++ +G+ YRG S+ GII Y Sbjct: 248 IYPLEVLKTRLAI---RKTGQ--YRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGI 302 Query: 694 YFGFYDTAR 720 Y+T + Sbjct: 303 DLAVYETLK 311 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = +3 Query: 168 GGISAAVSKTAVAPIERVKLLLQVQ 242 GG A VS+TA AP++R+K+LLQVQ Sbjct: 143 GGALAGVSRTATAPLDRLKVLLQVQ 167 Score = 36.3 bits (80), Expect = 0.027 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 517 YPLDFARTRLAADVG-KGDGQREFSGLGNCISKIFKSDGLIGLYRG 651 YPL RTRL A KG GQ + + + + KI DG GLYRG Sbjct: 346 YPLSLVRTRLQAQAREKGGGQGD--NMVSVLRKIITEDGFKGLYRG 389 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/51 (27%), Positives = 30/51 (58%) Frame = +2 Query: 272 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 424 +Y+G++ A I +++G+ SF+RG F +++ P ++ A + K +L Sbjct: 265 QYRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGIDLAVYETLKNFYL 315 >SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) Length = 773 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 580 EFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDT-ARGMLP 732 ++SG+G ++KI++ +GL G ++G G ++ I+ Y A F Y+ +G+ P Sbjct: 590 KYSGVGGTLAKIYRDEGLYGYFKGNGTNIVRIVPYTAVQFAAYEEFKKGIAP 641 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = +2 Query: 272 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 415 +Y G+ +I +++GL +++GN N++R P A+ FA +++K+ Sbjct: 590 KYSGVGGTLAKIYRDEGLYGYFKGNGTNIVRIVPYTAVQFAAYEEFKK 637 Score = 36.3 bits (80), Expect = 0.027 Identities = 18/71 (25%), Positives = 36/71 (50%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 YPLD R R+ + +G+G ++S + I +S+G IGL++G ++ + Sbjct: 700 YPLDVVRRRMQME--RGEGMFKYSSTWDGFKVIVRSEGFIGLFKGMWPNLLKVAPTIGIQ 757 Query: 697 FGFYDTARGML 729 F Y+ ++ + Sbjct: 758 FAVYEVSKSAM 768 >SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 375 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 254 EIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 394 ++ + G++ F + K +G+ +FW+GN + IR FP A+ +A Sbjct: 87 QVGTQEAKPGLIRTFASVYKREGIKAFWKGNGVSCIRLFPYSAVQYA 133 Score = 32.3 bits (70), Expect = 0.44 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +3 Query: 141 VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQV 239 + + + FL GG SA ++++ +P+E VK+L QV Sbjct: 56 ITWFQSFLCGGTSAVLARSLTSPLEVVKVLAQV 88 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +1 Query: 589 GLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGMLPDPKNTPIVING 765 GL + ++K +G+ ++G GVS + Y A + ++ L DP N + +G Sbjct: 96 GLIRTFASVYKREGIKAFWKGNGVSCIRLFPYSAVQYAAFNRIVASLEDPHNGELSDSG 154 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 162 LAGGISAAVSKTAVAPIERVKLLLQVQHVSK 254 LAG S ++ V P E +K L VQHV+K Sbjct: 157 LAGTSSTLIAMVTVYPCEVIKTRLTVQHVNK 187 >SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +2 Query: 287 VDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFW 454 +DA ++IP+ +GL S WRG ++ P + F D+ K + G + +T W Sbjct: 64 IDALIKIPRYEGLSSLWRGLPPTMVMAVPNTVIYFTLYDQLK-ISYGFKNNETNLW 118 >SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 264 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLI-GLYRGFGVSVQGIIIYRAS 693 YPLD R R+ DG + ++ N + ++K DG+ GLYRG ++ + A Sbjct: 191 YPLDVVRRRMQLAGAVPDGHK-YNTCINTLVNVYKDDGIRRGLYRGLSINYLRVCPQVAI 249 Query: 694 YFGFYDTARGML 729 FG Y+ + L Sbjct: 250 MFGVYEVTKQFL 261 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/45 (35%), Positives = 29/45 (64%) Frame = +2 Query: 284 IVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 418 ++ AF I + +GLL++++GN A ++R FP A+ F + Y +V Sbjct: 13 VLTAFRAIYRNEGLLAYFKGNGAMMLRTFPYGAVQFLSYEHYSKV 57 Score = 35.9 bits (79), Expect = 0.036 Identities = 24/64 (37%), Positives = 31/64 (48%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 YPLD R+RLA V + G + CIS K G LY+GF ++ + I A Sbjct: 83 YPLDMVRSRLAFQVAQDQGYTTITQTIRCIS--VKEGGPKALYKGFVPTL--LTIVPAMG 138 Query: 697 FGFY 708 GFY Sbjct: 139 IGFY 142 >SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) Length = 302 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 514 VYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRG 651 V PLD +TRL + + G+ ++G+ +C KI+ ++GL Y+G Sbjct: 223 VNPLDVIKTRLQL-LNRPQGEPNYNGIIDCAKKIYSNEGLAAFYKG 267 >SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 200 Score = 36.7 bits (81), Expect = 0.020 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSD-GLIGLYRGFGVSVQGIIIYRAS 693 YPLD R+RLA V + + G+ + +IF ++ G++ LYRGF + + + A Sbjct: 17 YPLDIVRSRLAFQVA---DEHTYCGICQTVKQIFMTEGGMVALYRGF--TPTSLSMIPAV 71 Query: 694 YFGFY 708 GFY Sbjct: 72 GIGFY 76 Score = 35.1 bits (77), Expect = 0.062 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGL-IGLYRGFGVSVQGIIIYRAS 693 YPLD R R+ DG + +S N ++ DG+ GLYRG ++ + A Sbjct: 125 YPLDVVRRRMQLAGTVADGHK-YSTCINTFISVYTEDGIRRGLYRGLSINYLRVCPQVAV 183 Query: 694 YFGFYDTARGML 729 F Y+ + +L Sbjct: 184 MFAVYEVVKQLL 195 >SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) Length = 192 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 424 Y + +A R+ KE+G+L+ WRG +R A A + KQ+ L Sbjct: 35 YTNVFNALYRMSKEEGVLTLWRGYIPTAVRAMVVNAAQLATYSQAKQLLL 84 Score = 34.7 bits (76), Expect = 0.083 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV---FLGG 430 YKG +D RI + +G+ + W+G R P L F F ++ + F GG Sbjct: 133 YKGTMDVLARIVRNEGVFALWKGFTPYYFRIGPHTVLTFIFLEQLNRAANYFYGG 187 Score = 33.9 bits (74), Expect = 0.14 Identities = 14/45 (31%), Positives = 31/45 (68%) Frame = +1 Query: 520 PLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGF 654 P+D A+TR+ ++ DG+ E+ G + +++I +++G+ L++GF Sbjct: 113 PVDIAKTRIQ-NMRIIDGKPEYKGTMDVLARIVRNEGVFALWKGF 156 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 574 QREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFY 708 Q ++G +C+ K+F S+GL G +RG ++ I A YFG + Sbjct: 294 QMAYTGSLDCLKKVFHSEGLRGCFRGMAITTTRDIPAFALYFGSF 338 Score = 33.1 bits (72), Expect = 0.25 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 583 FSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFG 702 ++G+ +C +I K + ++GLY+G + G+ + A FG Sbjct: 191 YNGVFDCFKQIIKRESVLGLYKGMASPLAGLGLINAIIFG 230 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +1 Query: 517 YPLDFARTRLAAD--VGKGDGQREFSGLGNCISKIFKSDGLIGLYRG 651 YP+D ++ AD G Q +++G +C+ KI+ S G+ +G Sbjct: 376 YPVDMVKSCYQADGRTNSGKPQYKYNGYADCVKKIYISGGVSAFGQG 422 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 272 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQA 382 +Y G D +I G+ +F +G A ++R FPT A Sbjct: 399 KYNGYADCVKKIYISGGVSAFGQGLLATILRGFPTNA 435 >SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 1024 Score = 36.3 bits (80), Expect = 0.027 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +1 Query: 580 EFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGML 729 +FSG+ + K++G+ L++G G ++ G+ RA YF Y + ML Sbjct: 773 KFSGIVPYARYMVKNEGIQSLFKGLGTTLLGVTPSRAIYFAIYSKLKDML 822 Score = 33.1 bits (72), Expect = 0.25 Identities = 20/73 (27%), Positives = 33/73 (45%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 YP + ARTRL + G++++ + + + +G GLY G G V + A Sbjct: 950 YPHEVARTRLRQQESEFLGRQKYRSFFQTLGTVLREEGWRGLYGGLGTHVIRQVPNTAIM 1009 Query: 697 FGFYDTARGMLPD 735 F Y+ +L D Sbjct: 1010 FFTYEGVVYILRD 1022 >SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 35.1 bits (77), Expect = 0.062 Identities = 17/73 (23%), Positives = 36/73 (49%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 +P ++ +T+L D + + + G +C+ K K G++GLYRG + G + + Sbjct: 59 FPTEYVKTQLQLD--EKAAKPIYRGPIDCVKKTVKGHGVLGLYRGLSSLLYGSVPKASVR 116 Query: 697 FGFYDTARGMLPD 735 F ++ + + D Sbjct: 117 FAVFEYLKNKMAD 129 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/66 (28%), Positives = 29/66 (43%) Frame = +2 Query: 254 EIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGV 433 E AA Y+G +D + K G+L +RG + + P ++ FA + K Sbjct: 72 EKAAKPIYRGPIDCVKKTVKGHGVLGLYRGLSSLLYGSVPKASVRFAVFEYLKNKMADEN 131 Query: 434 DKKTQF 451 K TQF Sbjct: 132 GKLTQF 137 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 34.7 bits (76), Expect = 0.083 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF--LGGVDKKT 445 Y+G++ + KE+G+ +F+R + P Q L+F + ++ LGG D KT Sbjct: 32 YRGVIHCATSVFKEEGIRAFYRSYTTQLSMNIPFQTLHFTVYEYARKALNPLGGYDPKT 90 Score = 31.9 bits (69), Expect = 0.58 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +1 Query: 583 FSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGML 729 + G+ +C + +FK +G+ YR + + I ++ +F Y+ AR L Sbjct: 32 YRGVIHCATSVFKEEGIRAFYRSYTTQLSMNIPFQTLHFTVYEYARKAL 80 >SB_21443| Best HMM Match : Mito_carr (HMM E-Value=2.8e-26) Length = 205 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/84 (27%), Positives = 38/84 (45%) Frame = +1 Query: 475 GLRWCRRSHLSGFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGF 654 G+ C +H + V PLD + R+ D +++ + N K DG+ GL RG+ Sbjct: 62 GILSCGLTHTA--VVPLDLVKCRIQVD------PKKYGSMVNGFKITLKEDGVRGLARGW 113 Query: 655 GVSVQGIIIYRASYFGFYDTARGM 726 + G + FGFY+ + M Sbjct: 114 APTFIGYSMQGLGKFGFYEVFKIM 137 >SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 274 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 514 VYPLDFARTRLAADV-GKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRA 690 + P+D + +L K + + G +C+ K+++S GL G ++G V+ I A Sbjct: 51 IAPVDLVKIKLQMQTEAKRSTRSVYRGPVDCLVKLYRSRGLAGCFQGNTVTAVRDIPGFA 110 Query: 691 SYFGFYD 711 YFG Y+ Sbjct: 111 VYFGVYE 117 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +2 Query: 272 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 391 RYKG++D ++ KE+G++ F RG + ++R F Q L F Sbjct: 170 RYKGMMDCALQSYKEEGMIVFTRGIWPTLLRGF-LQVLRF 208 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 391 Y+G VD V++ + +GL ++GN +R P A+ F Sbjct: 75 YRGPVDCLVKLYRSRGLAGCFQGNTVTAVRDIPGFAVYF 113 >SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 305 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 418 +P+E L W G F++VI F A+N AF+++YK++ Sbjct: 272 LPREVYLFYSWIGAFSSVINPFIYGAMNPAFREEYKKI 309 >SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) Length = 247 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 535 RTRLAADVGKGDGQR-EFSGLGNCISKIFKSDGLIGLYRGFG 657 R + V K G + + GLG+C+ +++++ GL G+++G G Sbjct: 183 RVKCLLQVQKESGTKARYQGLGDCLLQVYRTGGLRGVFKGLG 224 >SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 305 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 418 +P+E +L W G ++VI F A+N F+D+YK++ Sbjct: 139 LPREVYVLYTWLGTLSSVINPFIYGAMNPVFRDEYKKL 176 >SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 306 Score = 31.9 bits (69), Expect = 0.58 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 520 PLDFARTRLAADVGKGDGQR-EFSGLGNCISKIFKSDGLIGLYRGF 654 P+D RTR G+ + G +CI K + +G++ LY+GF Sbjct: 231 PVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALYKGF 276 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWRG 343 YK + AF +I K++G L W G Sbjct: 153 YKNMFHAFYKIAKKEGFLGLWTG 175 >SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 328 Score = 31.5 bits (68), Expect = 0.77 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 520 PLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVS 663 PLD R + + K G + G +C+ +I++ G+ G+Y+G V+ Sbjct: 157 PLD--RVKCILQIEKAFGGSSYGGPVDCLRRIYREAGVRGVYKGISVT 202 >SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05) Length = 383 Score = 31.5 bits (68), Expect = 0.77 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 598 NCISKIFKSDGLIGLYRGFGVSVQGIIIY 684 +C I++ +G+ G YRGFG + ++Y Sbjct: 332 DCFRTIYQQEGIFGFYRGFGALLIQCVVY 360 >SB_9806| Best HMM Match : Mito_carr (HMM E-Value=0.061) Length = 114 Score = 31.5 bits (68), Expect = 0.77 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 171 GISAAVSKTAVAPIERVKLLLQVQH 245 G+S +KT AP+ER+K+L Q Q+ Sbjct: 63 GLSTCCAKTTTAPLERLKILFQAQN 87 >SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 434 Score = 31.5 bits (68), Expect = 0.77 Identities = 17/65 (26%), Positives = 29/65 (44%) Frame = +1 Query: 517 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 +PLD R RL ++G+ + + +I +G+ GLY+G S+ I + Sbjct: 47 HPLDVVRARLTVQDMSTRSISNYTGIVSALRRIHIEEGIRGLYKGLVPSLVSIAPFLGVQ 106 Query: 697 FGFYD 711 YD Sbjct: 107 QSVYD 111 >SB_189| Best HMM Match : Peptidase_A17 (HMM E-Value=1.9e-35) Length = 965 Score = 31.5 bits (68), Expect = 0.77 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -1 Query: 181 AEIPPARKSLANATGSARFDILFDYVIFTR*ICRGGSCGTRGWGI 47 A++PP R +A + + FD+ + I TR RGG ++ WG+ Sbjct: 538 ADLPPDRTEVAPSFTNVGFDVFGPWTIHTR-KTRGGVLNSKRWGL 581 >SB_16027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -3 Query: 557 TSAARRVRAKSRGYTKPERWLRRHHRRPDYQRSNART 447 +S +RR RA++RG + +RW R HH + ++R T Sbjct: 59 SSYSRRARAETRGDRETKRW-RIHHTQEGHERKQEET 94 >SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 309 Score = 31.1 bits (67), Expect = 1.0 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 4/84 (4%) Frame = +1 Query: 520 PLDFARTRLAADVGKGDGQRE-FSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY 696 PLD + RL A G+ F G +C K + +GL GLY+G + ++ ++ Sbjct: 40 PLDLLKVRLQAMNQVKPGETAPFKGAMDCFMKTVRLEGLRGLYKGMLSPL--LMATPSTA 97 Query: 697 FGFYDTARG---MLPDPKNTPIVI 759 FY + G L DP P ++ Sbjct: 98 LTFYSLSVGKRIQLSDPYQEPTLV 121 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +2 Query: 275 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 391 +KG +D F++ + +GL ++G + ++ P+ AL F Sbjct: 62 FKGAMDCFMKTVRLEGLRGLYKGMLSPLLMATPSTALTF 100 >SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 276 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 135 DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 242 DP K F + GI+A++++ A PI+ K+ LQ+Q Sbjct: 11 DPSILVK-FCSAGIAASIAEAATIPIDTAKVRLQIQ 45 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +1 Query: 583 FSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGMLPD 735 + G+ + +FK++G+ +Y+G + + + + G YD + M D Sbjct: 66 YRGMLGTMVTLFKTEGMKTMYKGLIPGIHRQLCFASIRIGLYDQVKAMYGD 116 >SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 181 AEIPPARKSLANATGSARFDILFDYVIFTR*ICRGGSCGTRGWGI 47 A++PP R +A + FD+ + I TR RGG ++ WG+ Sbjct: 1265 ADLPPDRTEVAPPFTNVGFDVFGPWTIHTR-KTRGGVLNSKRWGL 1308 >SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21) Length = 198 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 165 AGGISAAVSKTAVAPIERVKLLLQ 236 AGG++ S+T AP+E++K++ Q Sbjct: 175 AGGVAGVASRTLTAPLEKMKIIAQ 198 >SB_23920| Best HMM Match : Mito_carr (HMM E-Value=0.00039) Length = 54 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +2 Query: 281 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 418 G+V + G +RGN A ++R P ++ F ++YK++ Sbjct: 1 GVVHVLTQTYTTNGFTGLFRGNSATMMRVVPYASIQFTSHEQYKKL 46 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 467 QRSNARTASSCQRRRGTPACTCP 399 Q + R S CQRRRG C CP Sbjct: 934 QLVSCRFYSKCQRRRGGAQCVCP 956 >SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 272 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 593 RPENSRWPSPLPTSAARRVRAKSRGYTK 510 RP +SR S P+SA+RR ++SRG + Sbjct: 221 RPSSSRPSSARPSSASRRASSRSRGLAR 248 >SB_45406| Best HMM Match : 7tm_2 (HMM E-Value=5.9) Length = 225 Score = 29.1 bits (62), Expect = 4.1 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 6/63 (9%) Frame = -3 Query: 560 PTSAARRVRAKSRGYTKPERWLRRHHRRPDY------QRSNARTASSCQRRRGTPACTCP 399 PT + R++R R T R LRRH R P + A T S C+ RR A T Sbjct: 119 PTLSLRKLRRHKRVPTLSLRKLRRHKRAPTLSLRKLRRHKRAPTLSLCRLRRHKRAPTLS 178 Query: 398 *RR 390 RR Sbjct: 179 LRR 181 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 560 PTSAARRVRAKSRGYTKPERWLRRHHRRP 474 PT + RR+R R T R LRRH R P Sbjct: 175 PTLSLRRLRRHKRSPTLSLRRLRRHKRAP 203 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 560 PTSAARRVRAKSRGYTKPERWLRRHHRRP 474 PT + RR+R R T R LRRH R P Sbjct: 189 PTLSLRRLRRHKRAPTLSLRRLRRHKRAP 217 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 680 MMIPCTDTPKPLYRPIRPSDLKILLMQ 600 +++PC P LYR +RP L+I + Q Sbjct: 587 IILPCPSDPCSLYRELRPQALQIQMSQ 613 >SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) Length = 338 Score = 28.7 bits (61), Expect = 5.4 Identities = 26/85 (30%), Positives = 33/85 (38%), Gaps = 3/85 (3%) Frame = -3 Query: 647 LYRPIRPSDLKILLMQFPRPENSRWPSPLPTSAARRVRAKSRGYTKPERW---LRRHHRR 477 L PI SD+K + N R TS+ + K G KP R LR H Sbjct: 161 LKNPITSSDVKPEKVT-QNTLNKRIEKKCRTSSFLSLEIKKNGQAKPPRVFASLRCHIDE 219 Query: 476 PDYQRSNARTASSCQRRRGTPACTC 402 +N +SC G+ ACTC Sbjct: 220 CSSGINNCHQDASCANTIGSFACTC 244 >SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 866 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 308 PKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 424 P+E L W G ++VI F +N F++++K+++L Sbjct: 815 PRELYLFYSWLGALSSVINPFIYGVMNPMFREEFKRIYL 853 >SB_3432| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-28) Length = 343 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 305 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 421 +P+E L + G ++VI F A+N F+++YK+VF Sbjct: 263 LPRELYFLYTYVGVLSSVINPFIYGAMNPMFREEYKKVF 301 >SB_45532| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-40) Length = 368 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 305 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 418 +P+E +L + G ++VI F A+N FK++YK++ Sbjct: 267 LPREVYVLYSFLGGLSSVINPFIYGAMNPIFKEQYKKI 304 >SB_43929| Best HMM Match : TLE_N (HMM E-Value=0.49) Length = 351 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +1 Query: 562 KGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGML 729 +G+ +E +GLG+ + + S G IGL G VQ +I+ + + G D R ++ Sbjct: 104 EGEMPKEATGLGDQVRSVIMSKGAIGL----GDQVQSVIMSKRA-IGLGDQVRSVI 154 >SB_32253| Best HMM Match : Mito_carr (HMM E-Value=1.6e-31) Length = 233 Score = 27.9 bits (59), Expect = 9.5 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = +1 Query: 520 PLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQ----GIIIYR 687 P+D +L G+GD + + G I + F G G Y+G+ S+ I+ Sbjct: 125 PVDIISQKLMIQ-GQGDRKVKLKGARILIRETFHQHGPGGFYKGYFASLMTYAPSSAIWW 183 Query: 688 ASYFGFYDTARGML 729 ASY GFY G L Sbjct: 184 ASY-GFYTGVIGNL 196 >SB_26302| Best HMM Match : Reg_prop (HMM E-Value=3.1e-06) Length = 117 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 281 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKY--KQVFLGGVDKKTQFW 454 G++ + V ++ + W G + +Y N+ +D V G+DKK Q W Sbjct: 17 GLIQSQVTAIEQDKMGHLWMGTIGGLAKYDGHTFTNYTIRDGLLNNSVTALGIDKKNQIW 76 >SB_6969| Best HMM Match : Astacin (HMM E-Value=0) Length = 225 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 589 GLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASY-FGFY 708 G C S + + G+ + GFG QG++++ + GFY Sbjct: 88 GFSKCWSYVGRIGGMQKISIGFGCFTQGVVVHEIGHALGFY 128 >SB_3306| Best HMM Match : DUF837 (HMM E-Value=0.71) Length = 238 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +1 Query: 562 KGDGQREFSGLGNCISKIFKSDGLIGLYRGFGVSVQGIIIYRASYFGFYDTARGML 729 +G+ +E +GLG+ + + S G IGL G VQ +I+ + + G D R ++ Sbjct: 55 EGEMPKEATGLGDQVRSVIMSKGAIGL----GDQVQSVIMSKRA-IGLGDQVRSVI 105 >SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +3 Query: 117 KMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 242 K+ N P + G +S +SK + P + +K +QVQ Sbjct: 19 KVHNPYKPADVIESLTCGALSGMISKAVILPFDIIKKRIQVQ 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,536,744 Number of Sequences: 59808 Number of extensions: 433077 Number of successful extensions: 1494 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 1261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1479 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -