BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20660 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 0.95 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 5.0 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 5.0 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 5.0 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 6.7 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 26.2 bits (55), Expect = 0.95 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 376 AGPIPQLRSHGTTRQGQTS*LECKHG 299 AGPIP + H +Q Q S L KHG Sbjct: 244 AGPIPSQQKHQQHQQQQQSVLLPKHG 269 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 5.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 13 HLWSRWSRSVLS 48 H+W+RW R LS Sbjct: 1639 HIWNRWHREYLS 1650 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 229 IRRTHCRWCGELHLEIC---LKDLEEDHACIPIKKSDP 333 +R+ HCR CG++ C L E+ P++ P Sbjct: 1822 LRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGP 1859 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 229 IRRTHCRWCGELHLEIC---LKDLEEDHACIPIKKSDP 333 +R+ HCR CG++ C L E+ P++ P Sbjct: 1823 LRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGP 1860 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 355 VAEESDQLCLSKSPNKHNRLFMKAQPMP 438 V + LC + SPN + + QP P Sbjct: 154 VNSRGNTLCAASSPNAYTNTTIAVQPAP 181 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,938 Number of Sequences: 2352 Number of extensions: 15567 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -