BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20656 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 27 0.17 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 25 0.69 DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 23 2.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.1 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 23 2.1 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 8.5 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 27.1 bits (57), Expect = 0.17 Identities = 20/87 (22%), Positives = 39/87 (44%) Frame = +2 Query: 338 SPPEPLGRS*TLRQDSDEAHDDGRKESTAPDRSYRSGEGKEQIPERHRELRSH*AEATET 517 SPP PL S +D D D + + ++ +R +G +E +R R+ + + + Sbjct: 1396 SPPTPLSISRAGSRDEDSTRDSTKLDRSSREREVHNGGQQE---DRDRKTLTSAPQQPQQ 1452 Query: 518 CEKNSLPQRTSLSKRNQLEPLLYNSYS 598 ++ Q+ + N P L+N Y+ Sbjct: 1453 QQQQQQQQQQQQQQLNHY-PDLHNLYA 1478 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 218 LRRPRSLYSTVSKV*FEPAEAHRDSGEEPASGQR 319 LRR R L +TV++ H DSG ++ QR Sbjct: 248 LRRSRMLTATVNRNHLSGGTNHWDSGRRKSAAQR 281 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 314 QRRCRSGESPPEPLGR 361 Q +C GE+P +P+GR Sbjct: 51 QLKCALGEAPCDPVGR 66 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 73 SVSDTPSLKDLPKVATDLKS 132 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 314 QRRCRSGESPPEPLGR 361 Q +C GE+P +P+GR Sbjct: 51 QLKCALGEAPCDPVGR 66 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +1 Query: 121 DLKSQLEGFNTSCLRDVDTNEKIV 192 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,177 Number of Sequences: 438 Number of extensions: 4041 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -