BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20653 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44464| Best HMM Match : Adaptin_N (HMM E-Value=0) 110 1e-24 SB_27966| Best HMM Match : RCSD (HMM E-Value=0.11) 34 0.13 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 31 1.2 SB_37963| Best HMM Match : Aldedh (HMM E-Value=1.8e-16) 29 2.7 SB_53400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_29383| Best HMM Match : Gamma-thionin (HMM E-Value=7.5) 29 4.8 SB_22229| Best HMM Match : Arm (HMM E-Value=0) 28 6.3 >SB_44464| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 596 Score = 110 bits (264), Expect = 1e-24 Identities = 55/66 (83%), Positives = 59/66 (89%) Frame = +3 Query: 213 REKEGGR*KGYSIHTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMA 392 R+KE + K + TVGKDVS+LFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMA Sbjct: 29 RKKEAVK-KVIASMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMA 87 Query: 393 VNTFVK 410 VNTFVK Sbjct: 88 VNTFVK 93 Score = 55.6 bits (128), Expect = 4e-08 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +1 Query: 133 MTDSKYFTTTKKGEIFELKSELNSDXXXXXXXXXXXXIASIQLEK 267 MTDSKYFTTTKKGEIFELK+ELNSD IAS+ + K Sbjct: 1 MTDSKYFTTTKKGEIFELKAELNSDKKDRKKEAVKKVIASMTVGK 45 >SB_27966| Best HMM Match : RCSD (HMM E-Value=0.11) Length = 652 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/46 (45%), Positives = 25/46 (54%) Frame = +1 Query: 511 KVPER*RSLCPENCSRVRRKVI*YLFKHG*RSGLLRSTKRSVERFE 648 K+PE SLC ENC+ K + YL S L STKRS+ R E Sbjct: 48 KIPEH-TSLCLENCTFRHCKAVRYLMATN-DSNLSTSTKRSISRLE 91 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/53 (26%), Positives = 31/53 (58%) Frame = +2 Query: 524 DEDPYVRKTAAVCVAKLYDISSSMVEDQGFLDQLKDLLSDSNPMVVANAVAAL 682 D V++ AA+CV KL+ ++ +++ + ++ LL+D + VV +A + + Sbjct: 172 DTSDSVKQCAALCVLKLFRLNENLLPPGEWTSRIVQLLNDKHLGVVTSATSLI 224 >SB_37963| Best HMM Match : Aldedh (HMM E-Value=1.8e-16) Length = 266 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +3 Query: 336 VYLYLMNYAKSQPDMAIMAVNTFVKDCEDSNPLIRALAVRTMGCIRVDKITEY 494 VY + + K D+A+ A N K S+P RA +R + + D++ E+ Sbjct: 36 VYCKVPDSGKEHVDLAVAAANAAFKSWSVSSPAYRAERLRKLADLIEDRLEEF 88 >SB_53400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1130 Score = 29.1 bits (62), Expect = 3.6 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +2 Query: 431 IDSSFGCTDYGMHSS--GQDYRISMRTIRK-CLKDEDPYVRKTAAVCVAKLYDISSSMVE 601 ++ + C+ G +S QD I +R K L+D R T A+C KLY S + Sbjct: 386 VNLMYKCSSVGPPTSHSDQDEPIEVRHRHKRALQDSARAKRVTRAICRDKLY--SCKLWA 443 Query: 602 DQGFLDQLKDLLSDSNP 652 QGF + KD + P Sbjct: 444 KQGFCEIRKDFMPTECP 460 >SB_29383| Best HMM Match : Gamma-thionin (HMM E-Value=7.5) Length = 198 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 488 CNLVHSNASHSPYSQSSNQWIGILTVL 408 CN +S SH S++W+GIL L Sbjct: 154 CNCQNSERSHGSLQSLSSEWLGILKAL 180 >SB_22229| Best HMM Match : Arm (HMM E-Value=0) Length = 1050 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 279 LFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVN 398 +FP V+NC++ + + K V + AK P++A + VN Sbjct: 250 IFPAVLNCLKDPDEYVCKNVATLIREIAKHTPELAQLIVN 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,722,739 Number of Sequences: 59808 Number of extensions: 385431 Number of successful extensions: 1055 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1054 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -