BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20651 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 26 1.3 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 25 2.3 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 3.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.3 AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. 23 9.2 AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. 23 9.2 AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. 23 9.2 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 150 GLATDEADPYLATWLQYRAHGKKHNDAQSHQRPPGNNP 263 G ATD + LA Q + H +H Q HQ+ ++P Sbjct: 293 GSATDNNNYILAQQQQQQHHHHQHQPQQQHQQQYHSHP 330 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 351 TVCHGPQRGLRG*TRSQRCP*CVATVSRGLDCFQVVFDGFAH 226 T+C G G+ ++Q C C A V GL+C Q + FA+ Sbjct: 12 TLC-GEVTGVSYRGQAQTCRNCAAPVHHGLNCVQNRQNRFAN 52 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 249 PGNNPALEKLLPHIKGNVGFVFTRGD 326 PG + K P +KGNVG+ +GD Sbjct: 723 PGRHGQTVKGEPGLKGNVGYSGDKGD 748 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/62 (22%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -2 Query: 532 GLQDVYIVMISIVPF-EILVGIERAWKKEVFSGPRPVLWAGMTTDNGAMAPGRAGAWTLF 356 GL+++ + ++ F + + GI+ A K ++ R + N ++ GR G ++F Sbjct: 2287 GLEELKLAPLTYHTFHKEIKGIDEAKSKNIWDALREKSFLTTDCTNPSLCHGREGTKSIF 2346 Query: 355 SN 350 S+ Sbjct: 2347 SD 2348 >AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 609 LSRYMILELFLHLKFWTSNQKISVPSSKLE 698 L RY++L FL++ F+TS + PS ++ Sbjct: 4 LRRYILL--FLNICFYTSGAEAKAPSRPVQ 31 >AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 609 LSRYMILELFLHLKFWTSNQKISVPSSKLE 698 L RY++L FL++ F+TS + PS ++ Sbjct: 4 LRRYILL--FLNICFYTSGAEAKAPSRPVQ 31 >AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 609 LSRYMILELFLHLKFWTSNQKISVPSSKLE 698 L RY++L FL++ F+TS + PS ++ Sbjct: 4 LRRYILL--FLNICFYTSGAEAKAPSRPVQ 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 803,271 Number of Sequences: 2352 Number of extensions: 16630 Number of successful extensions: 48 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -