BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20650 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.9 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 6.7 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 21 8.9 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 8.9 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/23 (30%), Positives = 11/23 (47%) Frame = +1 Query: 439 TCGKGVRLAPDQGSCSRAQGSKC 507 +C + + P G C + G KC Sbjct: 587 SCAENMMFDPMSGKCEYSLGEKC 609 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.0 bits (42), Expect = 6.7 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 9 DAER--VARPLHPPRHDRAPRRLLAFTKSRLTSSSSAIVVI 125 DA R A+PL R+ R PR+ L F T ++ +++ Sbjct: 267 DANRNDCAKPLTQIRNIRGPRKRLRFAYVTRTGANIKKLIV 307 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 273 GLHGAASWSRSSK 235 GLH ASW +S K Sbjct: 413 GLHFHASWLKSKK 425 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 273 GLHGAASWSRSSK 235 GLH ASW +S K Sbjct: 420 GLHFHASWLKSKK 432 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 8.9 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -3 Query: 511 WHTWSP 494 WHTW P Sbjct: 475 WHTWMP 480 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.6 bits (41), Expect = 8.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 393 GADGLPLQRRPADARTRRVAS 331 GA G RPA A+ RRVA+ Sbjct: 298 GAGGPLHDHRPALAQQRRVAA 318 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,395 Number of Sequences: 336 Number of extensions: 1480 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -