BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20650 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 1.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.6 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 7.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 7.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 7.8 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = -1 Query: 378 PLQRRPADARTRRVASCLARRREDKEGSSGEEVGPGLHGAASWSR 244 PL +P +++ +ARR E S ++G A WSR Sbjct: 348 PLHCKPELGQSQSSPKFVARREESNSSSPSLDLGKEGGLEAQWSR 392 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 24 ARPLHPPRHDRA-PRRLLAFTKSRLTSSSSA 113 +RPLHPP + P + T + T++++A Sbjct: 91 SRPLHPPASSTSLPATITTTTTTTTTTTATA 121 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 420 ERGVDVPVGGADGLPLQRRPADAR 349 +R +PVG +P PAD R Sbjct: 260 KRFFGLPVGVTAAIPTSENPADYR 283 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 420 ERGVDVPVGGADGLPLQRRPADAR 349 +R +PVG +P PAD R Sbjct: 260 KRFFGLPVGVTAAIPTSENPADYR 283 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 420 ERGVDVPVGGADGLPLQRRPADAR 349 +R +PVG +P PAD R Sbjct: 260 KRFFGLPVGVTAAIPTSENPADYR 283 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,571 Number of Sequences: 438 Number of extensions: 1789 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -