BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20646 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 33 0.003 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 33 0.003 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 29 0.028 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 26 0.35 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.35 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.46 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 1.1 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 1.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 4.3 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 5.7 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.5 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 32.7 bits (71), Expect = 0.003 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 87 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 182 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 353 FLINLIDSPGHVDFSSEVTAALRVTDGAL 439 + + +ID+PGH DF + D A+ Sbjct: 85 YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 32.7 bits (71), Expect = 0.003 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 87 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 182 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 353 FLINLIDSPGHVDFSSEVTAALRVTDGAL 439 + + +ID+PGH DF + D A+ Sbjct: 85 YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 29.5 bits (63), Expect = 0.028 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 114 MSVIAHVDHGKSTLTDSL 167 ++++ HVDHGK+TL D+L Sbjct: 148 VTIMGHVDHGKTTLLDAL 165 Score = 26.6 bits (56), Expect = 0.20 Identities = 16/68 (23%), Positives = 26/68 (38%) Frame = +2 Query: 344 EKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAEASSLF 523 E G + +D+PGH F S +TD + QT + A + Sbjct: 190 ESGERVTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKEQTLQSIEMAKDAKVPII 249 Query: 524 CFMNKMDR 547 +NK+D+ Sbjct: 250 VAINKIDK 257 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 450 TVCLVCVYKPKQYCVRLLP 506 TV LVC+Y PK Y + P Sbjct: 749 TVTLVCLYSPKIYIILFQP 767 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 450 TVCLVCVYKPKQYCVRLLP 506 TV LVC+Y PK Y + P Sbjct: 839 TVTLVCLYSPKIYIILFQP 857 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.4 bits (53), Expect = 0.46 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 111 NMSVIAHVDHGKSTLTDSL 167 N+ I HV HGKST+ ++ Sbjct: 44 NIGTIGHVAHGKSTIVKAI 62 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 353 FLINLIDSPGHVDFSSEVTAALRVTDGAL 439 + + +ID+PGH DF + D A+ Sbjct: 12 YYVTIIDAPGHRDFIKNMITGTSQADCAV 40 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 353 FLINLIDSPGHVDFSSEVTAALRVTDGAL 439 + + +ID+PGH DF + D A+ Sbjct: 28 YYVTIIDAPGHRDFIKNMITGTSQADCAV 56 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 4.3 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 92 VHHPTDLVYREIHH 51 +HHP + R++HH Sbjct: 400 LHHPNCKINRKVHH 413 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 272 ISMFFELEEKDLVFITNPDQREKSEKGFLI 361 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 456 TQSTTTRAP-SVTRSAAVTSEEKSTC 382 + STTT +P + T+S V + STC Sbjct: 324 SSSTTTTSPMTSTKSTIVRNHLNSTC 349 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 272 ISMFFELEEKDLVFITNPDQREKSEKGFLI 361 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/33 (27%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 450 TVCLVCVYKPKQYCVRLLP-RHQAYSVS*TKWT 545 +V + C++ PK Y + + P R+ S+ T+++ Sbjct: 891 SVTIACLFSPKLYIILIRPERNVRQSMMPTRYS 923 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 605 QYAGTSGIVLQLQVG 561 +Y SG+V+QLQ G Sbjct: 1549 EYGAVSGLVVQLQRG 1563 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,988 Number of Sequences: 438 Number of extensions: 3860 Number of successful extensions: 18 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -