BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20645 (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 5.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.7 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 21 9.7 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 9.7 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 9.7 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 347 HHWLKVDFNRWQDEDESGDDLDNMND 424 H + K+D + D+ DD D+M++ Sbjct: 274 HKYEKIDKEEHESMDDDDDDDDDMSN 299 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.7 Identities = 13/52 (25%), Positives = 24/52 (46%) Frame = -2 Query: 353 NGVSFYHLLMKASMAHQPFLSPIVPQLTFLC*PHALFRINFSIKWY*NLVHF 198 +G+S YHL +M P L C P + ++ S++ Y +L+ + Sbjct: 580 SGLS-YHLSCAENMMFDPMSGKCEYSLGEKCRPGQIIQVANSLRQYEDLLEY 630 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 431 KTCHSYCLNRLH 396 K C SYC N H Sbjct: 281 KNCLSYCFNLYH 292 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 431 KTCHSYCLNRLH 396 K C SYC N H Sbjct: 281 KNCLSYCFNLYH 292 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -2 Query: 473 FHYLHQIECSYLCPKTCHSY 414 FH L + LC CH Y Sbjct: 156 FHLLELEKVHELCDNFCHRY 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,466 Number of Sequences: 336 Number of extensions: 3210 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -