BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20645 (699 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L24804-1|AAA18537.1| 160|Homo sapiens p23 protein. 51 5e-06 BC003005-1|AAH03005.1| 160|Homo sapiens prostaglandin E synthas... 51 5e-06 BC019324-1|AAH19324.1| 525|Homo sapiens alanyl-tRNA synthetase ... 35 0.32 BC004172-1|AAH04172.1| 525|Homo sapiens alanyl-tRNA synthetase ... 35 0.32 BC058912-1|AAH58912.1| 362|Homo sapiens protein tyrosine phosph... 33 1.3 BC047685-1|AAH47685.1| 362|Homo sapiens protein tyrosine phosph... 33 1.3 BC035508-1|AAH35508.1| 361|Homo sapiens PTPLAD1 protein protein. 33 1.3 AK074898-1|BAC11277.1| 362|Homo sapiens protein ( Homo sapiens ... 33 1.3 AK027421-1|BAB55101.1| 362|Homo sapiens protein ( Homo sapiens ... 33 1.3 AJ271091-1|CAB69070.1| 370|Homo sapiens B-ind1 protein protein. 33 1.3 BC101353-1|AAI01354.1| 545|Homo sapiens potassium channel, subf... 30 9.1 BC101352-1|AAI01353.1| 545|Homo sapiens potassium channel, subf... 30 9.1 AL354723-2|CAI15124.1| 545|Homo sapiens potassium channel, subf... 30 9.1 AF348983-1|AAL83910.1| 545|Homo sapiens voltage-gated potassium... 30 9.1 >L24804-1|AAA18537.1| 160|Homo sapiens p23 protein. Length = 160 Score = 50.8 bits (116), Expect = 5e-06 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 8/53 (15%) Frame = +2 Query: 317 WPSLTSDKKKHHWLKVDFNRWQD-EDESGDDLDN-------MNDMFSDKDMNI 451 WP LT ++ K +WL VDFN W+D ED+S +D+ N MN+M D+D+++ Sbjct: 86 WPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDL 138 >BC003005-1|AAH03005.1| 160|Homo sapiens prostaglandin E synthase 3 (cytosolic) protein. Length = 160 Score = 50.8 bits (116), Expect = 5e-06 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 8/53 (15%) Frame = +2 Query: 317 WPSLTSDKKKHHWLKVDFNRWQD-EDESGDDLDN-------MNDMFSDKDMNI 451 WP LT ++ K +WL VDFN W+D ED+S +D+ N MN+M D+D+++ Sbjct: 86 WPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDL 138 >BC019324-1|AAH19324.1| 525|Homo sapiens alanyl-tRNA synthetase domain containing 1 protein. Length = 525 Score = 34.7 bits (76), Expect = 0.32 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +2 Query: 293 KEKVDEPYWPSLTSDKKKHHWLKVDFNRWQD 385 KEKV WP LT + K WL VDF+ W+D Sbjct: 64 KEKVA---WPRLTKEDIKPVWLSVDFDNWRD 91 >BC004172-1|AAH04172.1| 525|Homo sapiens alanyl-tRNA synthetase domain containing 1 protein. Length = 525 Score = 34.7 bits (76), Expect = 0.32 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +2 Query: 293 KEKVDEPYWPSLTSDKKKHHWLKVDFNRWQD 385 KEKV WP LT + K WL VDF+ W+D Sbjct: 64 KEKVA---WPRLTKEDIKPVWLSVDFDNWRD 91 >BC058912-1|AAH58912.1| 362|Homo sapiens protein tyrosine phosphatase-like A domain containing 1 protein. Length = 362 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 278 EVLLAKEKVDEPYWPSLTSDKKKHHWLKVDFNRWQDEDESGDDL 409 +V + +K +W LT +K+ +L DF+RW DE ++ +L Sbjct: 77 QVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL 120 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 51 MTSQVTPPSVSWAQRNARIFLTFNV-ECEKPDINIEPKSITFK 176 M +QV P V WAQR+ ++L + + + P I+I + FK Sbjct: 1 MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFK 43 >BC047685-1|AAH47685.1| 362|Homo sapiens protein tyrosine phosphatase-like A domain containing 1 protein. Length = 362 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 278 EVLLAKEKVDEPYWPSLTSDKKKHHWLKVDFNRWQDEDESGDDL 409 +V + +K +W LT +K+ +L DF+RW DE ++ +L Sbjct: 77 QVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL 120 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 51 MTSQVTPPSVSWAQRNARIFLTFNV-ECEKPDINIEPKSITFK 176 M +QV P V WAQR+ ++L + + + P I+I + FK Sbjct: 1 MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFK 43 >BC035508-1|AAH35508.1| 361|Homo sapiens PTPLAD1 protein protein. Length = 361 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 278 EVLLAKEKVDEPYWPSLTSDKKKHHWLKVDFNRWQDEDESGDDL 409 +V + +K +W LT +K+ +L DF+RW DE ++ +L Sbjct: 77 QVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL 120 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 51 MTSQVTPPSVSWAQRNARIFLTFNV-ECEKPDINIEPKSITFK 176 M +QV P V WAQR+ ++L + + + P I+I + FK Sbjct: 1 MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFK 43 >AK074898-1|BAC11277.1| 362|Homo sapiens protein ( Homo sapiens cDNA FLJ90417 fis, clone NT2RP3000171, weakly similar to Mus musculus partial mRNA for B-IND1 protein (B-ind1 gene). ). Length = 362 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 278 EVLLAKEKVDEPYWPSLTSDKKKHHWLKVDFNRWQDEDESGDDL 409 +V + +K +W LT +K+ +L DF+RW DE ++ +L Sbjct: 77 QVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL 120 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 51 MTSQVTPPSVSWAQRNARIFLTFNV-ECEKPDINIEPKSITFK 176 M +QV P V WAQR+ ++L + + + P I+I + FK Sbjct: 1 MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFK 43 >AK027421-1|BAB55101.1| 362|Homo sapiens protein ( Homo sapiens cDNA FLJ14515 fis, clone NT2RM1000800, weakly similar to Mus musculus partial mRNA for B-IND1 protein. ). Length = 362 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 278 EVLLAKEKVDEPYWPSLTSDKKKHHWLKVDFNRWQDEDESGDDL 409 +V + +K +W LT +K+ +L DF+RW DE ++ +L Sbjct: 77 QVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL 120 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 51 MTSQVTPPSVSWAQRNARIFLTFNV-ECEKPDINIEPKSITFK 176 M +QV P V WAQR+ ++L + + + P I+I + FK Sbjct: 1 MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFK 43 >AJ271091-1|CAB69070.1| 370|Homo sapiens B-ind1 protein protein. Length = 370 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 278 EVLLAKEKVDEPYWPSLTSDKKKHHWLKVDFNRWQDEDESGDDL 409 +V + +K +W LT +K+ +L DF+RW DE ++ +L Sbjct: 77 QVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL 120 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 51 MTSQVTPPSVSWAQRNARIFLTFNV-ECEKPDINIEPKSITFK 176 M +QV P V WAQR+ ++L + + + P I+I + FK Sbjct: 1 MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFK 43 >BC101353-1|AAI01354.1| 545|Homo sapiens potassium channel, subfamily V, member 2 protein. Length = 545 Score = 29.9 bits (64), Expect = 9.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 347 HHWLKVDFNRWQDEDESGDDLDNMNDMFSDKD 442 H W + ++N + +EDE G++ D D +++D Sbjct: 44 HGWTEGNYNYYIEEDEDGEEEDQWKDDLAEED 75 >BC101352-1|AAI01353.1| 545|Homo sapiens potassium channel, subfamily V, member 2 protein. Length = 545 Score = 29.9 bits (64), Expect = 9.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 347 HHWLKVDFNRWQDEDESGDDLDNMNDMFSDKD 442 H W + ++N + +EDE G++ D D +++D Sbjct: 44 HGWTEGNYNYYIEEDEDGEEEDQWKDDLAEED 75 >AL354723-2|CAI15124.1| 545|Homo sapiens potassium channel, subfamily V, member 2 protein. Length = 545 Score = 29.9 bits (64), Expect = 9.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 347 HHWLKVDFNRWQDEDESGDDLDNMNDMFSDKD 442 H W + ++N + +EDE G++ D D +++D Sbjct: 44 HGWTEGNYNYYIEEDEDGEEEDQWKDDLAEED 75 >AF348983-1|AAL83910.1| 545|Homo sapiens voltage-gated potassium channel Kv11.1 protein. Length = 545 Score = 29.9 bits (64), Expect = 9.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 347 HHWLKVDFNRWQDEDESGDDLDNMNDMFSDKD 442 H W + ++N + +EDE G++ D D +++D Sbjct: 44 HGWTEGNYNYYIEEDEDGEEEDQWKDDLAEED 75 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,839,754 Number of Sequences: 237096 Number of extensions: 1793001 Number of successful extensions: 3336 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3324 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -