BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20641 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.9 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.5 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 76 VQQYYTLFD---DPAQRANLVNMYNVETSFMTFEGV 174 + Q YT FD DP + N+ + V +M G+ Sbjct: 440 LNQLYTAFDVLTDPKKNPNVYKVETVGDKYMAVSGL 475 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 76 VQQYYTLFD---DPAQRANLVNMYNVETSFMTFEGV 174 + Q YT FD DP + N+ + V +M G+ Sbjct: 440 LNQLYTAFDVLTDPKKNPNVYKVETVGDKYMAVSGL 475 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 328 GGSSSHFNLPRTLIKTPPSNIG 263 G S NL L+ PP N G Sbjct: 364 GSSIPKLNLSTALMSQPPPNFG 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,200 Number of Sequences: 438 Number of extensions: 4557 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -