BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20636 (703 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 62 2e-11 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 25 3.0 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 4.0 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 4.0 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 4.0 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 4.0 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 24 4.0 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 4.0 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 4.0 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 4.0 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 4.0 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 4.0 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 4.0 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 4.0 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 4.0 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 4.0 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 4.0 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 4.0 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 4.0 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 4.0 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 24 4.0 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 24 4.0 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 4.0 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 4.0 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 4.0 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 4.0 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 4.0 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 24 4.0 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 5.3 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 7.0 AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 23 7.0 AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding pr... 23 7.0 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 9.3 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 62.1 bits (144), Expect = 2e-11 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 1/93 (1%) Frame = +2 Query: 245 VKSLGQNPTESDVKKCT-LHLKPDERISFEVFLPIYQAISKARSGDTANDFIEGLRHFDK 421 +++L NPT + K + +++I FE FLPI+ + K + DF+E L+ +DK Sbjct: 37 LRALNLNPTIELIGKMGGTQKRGEKKIKFEEFLPIFSQVKKEKEQGCFEDFLECLKLYDK 96 Query: 422 DGNGFISSAELRHLLSTLGEKLSDDEVEQSCRD 520 + +G + AEL H L+ LGE+L D E++ +D Sbjct: 97 NEDGTMLLAELTHSLTALGERLDDVELDNVMKD 129 Score = 26.2 bits (55), Expect = 1.00 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 162 QLAEFQEAFQLFDSRGDGKIHVAQIGDALRA 254 ++ + Q F ++D G G++ +G+ALRA Sbjct: 9 EIEKAQFVFSVYDWEGSGQMDAMDLGNALRA 39 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 379 VATACFRYGLVNWQKHLKRYPFIRFKMKS 293 VA+ C R N + +LKR+ +RF +S Sbjct: 347 VASDCTRMEFYNLKNYLKRFRVVRFVPES 375 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 242 FSQNLEHFDLRGNGF 256 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 261 CPKLLTHLRSERHVSF 214 C K++TH+R+ HV F Sbjct: 505 CGKVVTHIRNHYHVHF 520 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 392 FIEGLRHFDKDGNGF 436 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 165 IDPLNIQPYYESTNEIEGNEIGIF 94 ID L PYYE N G ++G F Sbjct: 187 IDRLKQLPYYEEANGGGGTDLGKF 210 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 614 ICKLTKSVTIQLEP*WDTVNKNL 682 +C+ TK +T L+ WD + L Sbjct: 1066 VCEATKRITSALQQDWDETRREL 1088 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 7.0 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 354 PYRKHAVATLLMTLLRVCAILTKMAMGSSLLRNCDTCSL--LSERS 485 P ++ LL+ L +IL + ++NC +CS+ +S+RS Sbjct: 313 PAQQDRFNVLLLILFLCVSILGTLITPELWMKNCKSCSISPVSDRS 358 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 497 EVEQSCRDKKTLREISTMRTLFTSSCRAEF 586 E SCRD + + S +T +++ C AE+ Sbjct: 119 EAIHSCRDVQGRYKDSCDKTFYSTKCLAEY 148 >AF437888-1|AAL84183.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 497 EVEQSCRDKKTLREISTMRTLFTSSCRAEF 586 E SCRD + + S +T +++ C AE+ Sbjct: 117 EAIHSCRDVQGRYKDSCDKTFYSTKCLAEY 146 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.0 bits (47), Expect = 9.3 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 394 KVISSVATACFRYGLVNWQKHL-KRYP 317 K+++SV+ + RY W K L KR P Sbjct: 777 KLLASVSESVMRYAAPVWSKELQKREP 803 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,882 Number of Sequences: 2352 Number of extensions: 13762 Number of successful extensions: 81 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -