BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20635 (781 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 142 2e-34 SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) 129 3e-30 SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 6e-24 SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) 50 2e-06 SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) 47 1e-05 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 37 0.016 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 37 0.021 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.028 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) 36 0.049 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 36 0.049 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.064 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 35 0.085 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 35 0.085 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 35 0.085 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 34 0.11 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 34 0.11 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 34 0.11 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 34 0.11 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 34 0.11 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 34 0.11 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 34 0.11 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 34 0.11 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 34 0.11 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 34 0.11 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 34 0.11 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 34 0.11 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 34 0.15 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 34 0.15 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 34 0.15 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 34 0.15 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 34 0.15 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 34 0.15 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 34 0.15 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 34 0.15 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_37530| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 34 0.15 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 34 0.15 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 34 0.15 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 34 0.15 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 34 0.15 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 33 0.20 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 33 0.20 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 33 0.20 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 33 0.20 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 33 0.20 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) 33 0.20 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 33 0.20 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.20 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 33 0.20 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 33 0.20 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 33 0.20 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 33 0.20 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_960| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.26 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.26 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.26 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.26 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.26 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.26 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.26 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.26 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 33 0.26 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.26 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.26 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.26 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 33 0.26 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.26 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.26 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.26 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.26 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 33 0.26 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 33 0.26 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 33 0.26 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.26 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 33 0.26 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.26 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 33 0.26 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 33 0.26 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 33 0.26 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 142 bits (345), Expect = 2e-34 Identities = 64/85 (75%), Positives = 75/85 (88%) Frame = +1 Query: 253 NDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSK 432 +DAILDAHL QDP+AKVACET+ KTGM+LLCGEITS A VDYQ VVR+ +K IGYDDS K Sbjct: 51 SDAILDAHLKQDPNAKVACETVAKTGMILLCGEITSNAVVDYQSVVRQCIKDIGYDDSEK 110 Query: 433 GFDYKTCSVMLALDQQSPNIAAGVH 507 GFDYKTC+V++AL+QQS +IA GVH Sbjct: 111 GFDYKTCNVLVALEQQSVDIAHGVH 135 Score = 72.9 bits (171), Expect = 3e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 513 RNDEEVGAGDQGLMFGYATDETEECMPLTVVLXHKLNQ 626 R +E+VGAGDQGLMFGYATDETEE MPLTVVL HK+NQ Sbjct: 138 REEEDVGAGDQGLMFGYATDETEELMPLTVVLAHKMNQ 175 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 188 SVFLFTSESVGEGHPDKMCDQ 250 + FLFTSESVGEGHPDKMCDQ Sbjct: 29 NTFLFTSESVGEGHPDKMCDQ 49 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = +2 Query: 629 KLQSFRRNGEFWWARPDSKTQVXCEY 706 KL +RR+G WARPDSKTQV EY Sbjct: 176 KLAEYRRDGTLPWARPDSKTQVTVEY 201 >SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 129 bits (311), Expect = 3e-30 Identities = 61/94 (64%), Positives = 72/94 (76%) Frame = +1 Query: 253 NDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSK 432 +DA+LDAHL QDP AKVACET TKTG+VLL GEITS A VDYQ VVR T++ IGY+DSS Sbjct: 72 SDAVLDAHLEQDPYAKVACETATKTGLVLLFGEITSNARVDYQAVVRNTIRDIGYNDSST 131 Query: 433 GFDYKTCSVMLALDQQSPNIAAGVHGTEMTRKLG 534 GFDYKTCSV+LA+ +Q IA VH ++G Sbjct: 132 GFDYKTCSVLLAIQEQVAEIAQTVHLNRRDDEIG 165 Score = 71.3 bits (167), Expect = 8e-13 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 510 NRNDEEVGAGDQGLMFGYATDETEECMPLTVVLXHKL 620 NR D+E+GAGDQGLMFGYATDETEE MPLT VL HKL Sbjct: 158 NRRDDEIGAGDQGLMFGYATDETEELMPLTTVLAHKL 194 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = +2 Query: 170 YDMEDGSVFLFTSESVGEGHPDKMCDQ 250 Y D FLFTSESV EGH DKMCDQ Sbjct: 44 YSTSDCDNFLFTSESVNEGHSDKMCDQ 70 >SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 113 bits (273), Expect = 1e-25 Identities = 50/74 (67%), Positives = 62/74 (83%) Frame = +1 Query: 313 TITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNI 492 ++ KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSKGFDYKTC+V+ A++QQSP+I Sbjct: 2 SVAKTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSKGFDYKTCTVLQAIEQQSPDI 61 Query: 493 AAGVHGTEMTRKLG 534 A GVH LG Sbjct: 62 AQGVHIGRSDEDLG 75 Score = 72.5 bits (170), Expect = 3e-13 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = +3 Query: 513 RNDEEVGAGDQGLMFGYATDETEECMPLTVVLXHKLNQ--XNCRASGEM 653 R+DE++GAGDQGLMFGYATDET+E MPLTVVL H LN+ +CR +G + Sbjct: 69 RSDEDLGAGDQGLMFGYATDETDELMPLTVVLAHGLNKRLADCRRNGSL 117 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +2 Query: 629 KLQSFRRNGEFWWARPDSKTQVXCEY 706 +L RRNG W RPDSKTQV EY Sbjct: 107 RLADCRRNGSLPWVRPDSKTQVTVEY 132 >SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 108 bits (259), Expect = 6e-24 Identities = 47/60 (78%), Positives = 56/60 (93%) Frame = +1 Query: 253 NDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSK 432 +DAILDAHL QDP+AKVACE++ KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSK Sbjct: 31 SDAILDAHLKQDPNAKVACESVAKTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSK 90 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 188 SVFLFTSESVGEGHPDKMCDQ 250 + FLFTSESVGEGHPDKMCDQ Sbjct: 9 NTFLFTSESVGEGHPDKMCDQ 29 >SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) Length = 192 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = +3 Query: 522 EEVGAGDQGLMFGYATDETEECMPLTVVLXHKL--NQXNCRASGEM 653 E+ GAGDQGLMFGYAT+ET+ MP V H+L Q R +G + Sbjct: 8 EDQGAGDQGLMFGYATNETDSLMPAPVYYAHRLVERQSELRRNGTL 53 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 644 RRNGEFWWARPDSKTQV 694 RRNG W RPD+K+QV Sbjct: 48 RRNGTLPWLRPDAKSQV 64 >SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) Length = 70 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 188 SVFLFTSESVGEGHPDKMCDQ 250 + FLFTSESVGEGHPDKMCDQ Sbjct: 29 NTFLFTSESVGEGHPDKMCDQ 49 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +1 Query: 253 NDAILDAHLNQDPDAKVAC 309 +DAILDAHL QDP+AKVAC Sbjct: 51 SDAILDAHLKQDPNAKVAC 69 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = -1 Query: 130 SLRHSEFRVSPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 S+ + +++ L P T + NSCSPGDPLVLER R Sbjct: 19 SIAIATHKLNTLFIPSTQMASNSCSPGDPLVLERPPPR 56 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P T+L NSCSPGDPLVLER R Sbjct: 14 PLTILGSNSCSPGDPLVLERPPPR 37 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P +LV NSCSPGDPLVLER R Sbjct: 13 PGRLLVSNSCSPGDPLVLERPPPR 36 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P+ LV NSCSPGDPLVLER R Sbjct: 22 PRARLVSNSCSPGDPLVLERPPPR 45 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 TV V NSCSPGDPLVLER R Sbjct: 7 TVTVSNSCSPGDPLVLERPPPR 28 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -1 Query: 67 NSCSPGDPLVLERAAHR 17 NSCSPGDPLVLERAA R Sbjct: 56 NSCSPGDPLVLERAAPR 72 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 +TV V NSCSPGDPLVLER R Sbjct: 210 KTVNVSNSCSPGDPLVLERPPPR 232 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +LV NSCSPGDPLVLER R Sbjct: 8 ILVSNSCSPGDPLVLERPPPR 28 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/39 (51%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -1 Query: 130 SLRHSEFRVSPL-I*PQTVLVPNSCSPGDPLVLERAAHR 17 +L + R+S L + + +LV NSCSPGDPLVLER R Sbjct: 7 TLISANIRISVLALKSRPMLVSNSCSPGDPLVLERPPPR 45 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P T + NSCSPGDPLVLER R Sbjct: 256 PVTEYISNSCSPGDPLVLERPPPR 279 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T L NSCSPGDPLVLER R Sbjct: 13 TALTSNSCSPGDPLVLERPPPR 34 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -1 Query: 130 SLRHSEFRVSPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 +L + ++ + P ++ NSCSPGDPLVLER R Sbjct: 37 TLSKPSYTITTYLSPLEPILSNSCSPGDPLVLERPPPR 74 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P L NSCSPGDPLVLERA R Sbjct: 10 PLPCLRSNSCSPGDPLVLERAPPR 33 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 QT L NSCSPGDPLVLER R Sbjct: 3 QTGLPSNSCSPGDPLVLERPPPR 25 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V+V NSCSPGDPLVLER R Sbjct: 6 VVVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -1 Query: 100 PLI*PQTVLVPNSCSPGDPLVLERAAHR 17 PL+ L+ NSCSPGDPLVLER R Sbjct: 46 PLLYTYIPLLSNSCSPGDPLVLERPPPR 73 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +LV NSCSPGDPLVLER R Sbjct: 4 MLVSNSCSPGDPLVLERPPPR 24 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +LV NSCSPGDPLVLER R Sbjct: 1 MLVSNSCSPGDPLVLERPPPR 21 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V++ NSCSPGDPLVLER R Sbjct: 4 VIISNSCSPGDPLVLERPPPR 24 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P +V NSCSPGDPLVLER R Sbjct: 86 PPSVSTSNSCSPGDPLVLERPPPR 109 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -1 Query: 100 PLI*PQTVLVPNSCSPGDPLVLERAAHR 17 P + T+ V NSCSPGDPLVLER R Sbjct: 5 PFVFRVTLEVSNSCSPGDPLVLERPPPR 32 >SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P V NSCSPGDPLVLER R Sbjct: 19 PPPVFTSNSCSPGDPLVLERPPPR 42 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 LV NSCSPGDPLVLER R Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P+ + NSCSPGDPLVLER R Sbjct: 25 PELLTASNSCSPGDPLVLERPPPR 48 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 LV NSCSPGDPLVLER R Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 QT + NSCSPGDPLVLER R Sbjct: 19 QTRVTSNSCSPGDPLVLERPPPR 41 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 97 LI*PQTVLVPNSCSPGDPLVLERAAHR 17 LI P NSCSPGDPLVLER R Sbjct: 27 LIVPNATAQSNSCSPGDPLVLERPPPR 53 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +++ NSCSPGDPLVLER R Sbjct: 13 IIISNSCSPGDPLVLERPPPR 33 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 VL NSCSPGDPLVLER R Sbjct: 16 VLASNSCSPGDPLVLERPPPR 36 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +L+ NSCSPGDPLVLER R Sbjct: 5 ILLSNSCSPGDPLVLERPPPR 25 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +3 Query: 18 RWAARSRTSGSPGLQEFGTRTV 83 R RSRTSGSPGLQEF T T+ Sbjct: 7 RGGGRSRTSGSPGLQEFDTPTI 28 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 VL NSCSPGDPLVLER R Sbjct: 36 VLTSNSCSPGDPLVLERPPPR 56 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 Q + + NSCSPGDPLVLER R Sbjct: 64 QKIKISNSCSPGDPLVLERPPPR 86 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 VL NSCSPGDPLVLER R Sbjct: 3 VLASNSCSPGDPLVLERPPPR 23 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 17 LISNSCSPGDPLVLERPPPR 36 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 Q ++ NSCSPGDPLVLER R Sbjct: 116 QKEIISNSCSPGDPLVLERPPPR 138 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 37 LISNSCSPGDPLVLERPPPR 56 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +++ NSCSPGDPLVLER R Sbjct: 13 IVISNSCSPGDPLVLERPPPR 33 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 24 LISNSCSPGDPLVLERPPPR 43 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 TV NSCSPGDPLVLER R Sbjct: 3 TVQASNSCSPGDPLVLERPPPR 24 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NITPNSPRAEFLQPGGSTSSRA 30 NI NS EFLQPGGSTSSRA Sbjct: 12 NIISNSMYIEFLQPGGSTSSRA 33 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 + ++ NSCSPGDPLVLER R Sbjct: 22 EVIITSNSCSPGDPLVLERPPPR 44 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 34 LISNSCSPGDPLVLERPPPR 53 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T ++ NSCSPGDPLVLER R Sbjct: 102 TFILSNSCSPGDPLVLERPPPR 123 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T + NSCSPGDPLVLER R Sbjct: 4 TYFISNSCSPGDPLVLERPPPR 25 >SB_13275| Best HMM Match : Phycoerythr_ab (HMM E-Value=0.23) Length = 250 Score = 35.5 bits (78), Expect = 0.049 Identities = 22/48 (45%), Positives = 27/48 (56%) Frame = +3 Query: 18 RWAARSRTSGSPGLQEFGTRTVWGYISGLTLNSECRRLQK*MDTRKPT 161 R RSRTSGSPGLQEF G G+ L+SE L+ D + P+ Sbjct: 7 RGGGRSRTSGSPGLQEFDVNNSIG-SEGMILSSE-EMLKDGRDLQNPS 52 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 16 LISNSCSPGDPLVLERPPPR 35 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V V NSCSPGDPLVLER R Sbjct: 191 VAVSNSCSPGDPLVLERPPPR 211 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P+ + NSCSPGDPLVLER R Sbjct: 28 PENKALSNSCSPGDPLVLERPPPR 51 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 ++++ NSCSPGDPLVLER R Sbjct: 24 SLIISNSCSPGDPLVLERPPPR 45 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +++ NSCSPGDPLVLER R Sbjct: 24 IVISNSCSPGDPLVLERPPPR 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 31 LISNSCSPGDPLVLERPPPR 50 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 347 IVSNSCSPGDPLVLERPPPR 366 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 + V+ NSCSPGDPLVLER R Sbjct: 43 RVVVTSNSCSPGDPLVLERPPPR 65 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.064 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -1 Query: 88 PQTVLVP--NSCSPGDPLVLERAAHR 17 P +L P NSCSPGDPLVLER R Sbjct: 14 PHELLAPTSNSCSPGDPLVLERPPPR 39 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 83 NSPRAEFLQPGGSTSSRA 30 + PR EFLQPGGSTSSRA Sbjct: 38 SDPRIEFLQPGGSTSSRA 55 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.1 bits (77), Expect = 0.064 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -1 Query: 97 LI*PQTVLVPNSCSPGDPLVLERAAHR 17 LI V + NSCSPGDPLVLER R Sbjct: 8 LISANIVHISNSCSPGDPLVLERPPPR 34 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 77 IVSNSCSPGDPLVLERPPPR 96 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V+ NSCSPGDPLVLER R Sbjct: 2 VITSNSCSPGDPLVLERPPPR 22 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 35.1 bits (77), Expect = 0.064 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -1 Query: 145 SIHF*SLRHSEFRVSPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 ++H R + R S + +L NSCSPGDPLVLER R Sbjct: 42 TVHLLEDRRTRKRESRVGHHTPILPSNSCSPGDPLVLERPPPR 84 >SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.064 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 92 ITPNSPRAEFLQPGGSTSSRAGRPPRW 12 +T EFLQPGGSTSSRA PRW Sbjct: 8 LTVGEKGIEFLQPGGSTSSRAA-TPRW 33 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.1 bits (77), Expect = 0.064 Identities = 20/39 (51%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 130 SLRHSEFRVSPLI*PQTVLVP-NSCSPGDPLVLERAAHR 17 SL S+ P I + +P NSCSPGDPLVLER R Sbjct: 15 SLHTSQALHHPFIQAKPYNIPSNSCSPGDPLVLERPPPR 53 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V+ NSCSPGDPLVLER R Sbjct: 9 VITSNSCSPGDPLVLERPPPR 29 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 67 NSCSPGDPLVLERAAHR 17 NSCSPGDPLVLERA R Sbjct: 24 NSCSPGDPLVLERAPPR 40 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.1 bits (77), Expect = 0.064 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 Q V NSCSPGDPLVLER R Sbjct: 20 QHVAASNSCSPGDPLVLERPPPR 42 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + V NSCSPGDPLVLER R Sbjct: 30 IAVSNSCSPGDPLVLERPPPR 50 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 85 IVSNSCSPGDPLVLERPPPR 104 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 13 IVSNSCSPGDPLVLERPPPR 32 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 6 IVSNSCSPGDPLVLERPPPR 25 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.1 bits (77), Expect = 0.064 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -1 Query: 109 RVSPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 R+ L P L NSCSPGDPLVLER R Sbjct: 9 RIEFLSNPPKNLRSNSCSPGDPLVLERPPPR 39 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + V NSCSPGDPLVLER R Sbjct: 8 LFVSNSCSPGDPLVLERPPPR 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 17 IISNSCSPGDPLVLERPPPR 36 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 67 NSCSPGDPLVLERAA 23 NSCSPGDPLVLERA+ Sbjct: 9 NSCSPGDPLVLERAS 23 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P ++ NSCSPGDPLVLER R Sbjct: 887 PFPLVTSNSCSPGDPLVLERPPPR 910 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 62 LLSNSCSPGDPLVLERPPPR 81 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T ++ NSCSPGDPLVLER R Sbjct: 10 TKVLSNSCSPGDPLVLERPPPR 31 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 7 ITISNSCSPGDPLVLERPPPR 27 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V + NSCSPGDPLVLER R Sbjct: 9 VFLSNSCSPGDPLVLERPPPR 29 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T L NSCSPGDPLVLER R Sbjct: 2 TSLSSNSCSPGDPLVLERPPPR 23 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +L NSCSPGDPLVLER R Sbjct: 77 LLTSNSCSPGDPLVLERPPPR 97 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +L NSCSPGDPLVLER R Sbjct: 4 LLASNSCSPGDPLVLERPPPR 24 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 3474 VVSNSCSPGDPLVLERPPPR 3493 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 Q + NSCSPGDPLVLER R Sbjct: 18 QVIYPSNSCSPGDPLVLERPPPR 40 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T + NSCSPGDPLVLER R Sbjct: 29 TFSISNSCSPGDPLVLERPPPR 50 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 2 LLSNSCSPGDPLVLERPPPR 21 >SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) Length = 141 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -3 Query: 98 TNITPNSPRAEFLQPGGSTSSRA 30 T +T + R EFLQPGGSTSSRA Sbjct: 9 TKVTAWARRIEFLQPGGSTSSRA 31 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 31 ALELVDPPGCRNSARG 78 ALELVDPPGCRNS G Sbjct: 12 ALELVDPPGCRNSIEG 27 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 19 VVSNSCSPGDPLVLERPPPR 38 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 ++ + NSCSPGDPLVLER R Sbjct: 43 ESTITSNSCSPGDPLVLERPPPR 65 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + V NSCSPGDPLVLER R Sbjct: 13 ISVSNSCSPGDPLVLERPPPR 33 >SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P V NSCSPGDPLVLER R Sbjct: 3 PIQVQTSNSCSPGDPLVLERPPPR 26 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +L NSCSPGDPLVLER R Sbjct: 87 LLTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +L NSCSPGDPLVLER R Sbjct: 10 MLASNSCSPGDPLVLERPPPR 30 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 4 IISNSCSPGDPLVLERPPPR 23 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/21 (80%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = -1 Query: 76 LVP-NSCSPGDPLVLERAAHR 17 LVP NSCSPGDPLVLER R Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L+ NSCSPGDPLVLER R Sbjct: 7 LLSNSCSPGDPLVLERPPPR 26 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 + L NSCSPGDPLVLER R Sbjct: 8 EVYLASNSCSPGDPLVLERPPPR 30 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 +V NSCSPGDPLVLER R Sbjct: 27 VVSNSCSPGDPLVLERPPPR 46 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 +++ + NSCSPGDPLVLER R Sbjct: 97 KSLKISNSCSPGDPLVLERPPPR 119 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -3 Query: 80 SPRAEFLQPGGSTSSRA 30 SP EFLQPGGSTSSRA Sbjct: 8 SPNIEFLQPGGSTSSRA 24 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 83 NSPRAEFLQPGGSTSSRA 30 +SP EFLQPGGSTSSRA Sbjct: 21 SSPMIEFLQPGGSTSSRA 38 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 TV NSCSPGDPLVLER R Sbjct: 872 TVKRSNSCSPGDPLVLERPPPR 893 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P + NSCSPGDPLVLER R Sbjct: 33 PYDNIASNSCSPGDPLVLERPPPR 56 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 13 IFLSNSCSPGDPLVLERPPPR 33 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 10 IVTSNSCSPGDPLVLERPPPR 30 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 48 IFLSNSCSPGDPLVLERPPPR 68 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 40 VSNSCSPGDPLVLERPPPR 58 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 31 ALELVDPPGCRNSAR 75 ALELVDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 117 VSNSCSPGDPLVLERPPPR 135 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 184 VSNSCSPGDPLVLERPPPR 202 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 88 IVTSNSCSPGDPLVLERPPPR 108 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 18 RWAARSRTSGSPGLQEFGTR 77 R RSRTSGSPGLQEF T+ Sbjct: 7 RGGGRSRTSGSPGLQEFDTK 26 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 49 IKISNSCSPGDPLVLERPPPR 69 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 18 RWAARSRTSGSPGLQEFGTR 77 R RSRTSGSPGLQEF T+ Sbjct: 7 RGGGRSRTSGSPGLQEFDTK 26 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 18 RWAARSRTSGSPGLQEFGTRTVW 86 R RSRTSGSPGLQEF R V+ Sbjct: 7 RGGGRSRTSGSPGLQEFDLRHVF 29 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 4 RVIFTSNSCSPGDPLVLERPPPR 26 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V+ NSCSPGDPLVLER R Sbjct: 185 VIQSNSCSPGDPLVLERPPPR 205 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 33 IFLSNSCSPGDPLVLERPPPR 53 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -1 Query: 115 EFRVSPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 + ++S ++ P+ + NSCSPGDPLVLER R Sbjct: 17 KIQISNILIPK--IASNSCSPGDPLVLERPPPR 47 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 64 VSNSCSPGDPLVLERPPPR 82 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 95 NITPNSPRAEFLQPGGSTSSRA 30 N P P EFLQPGGSTSSRA Sbjct: 14 NEIPTVPIIEFLQPGGSTSSRA 35 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T + NSCSPGDPLVLER R Sbjct: 8 TCALSNSCSPGDPLVLERPPPR 29 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 6 LASNSCSPGDPLVLERPPPR 25 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 19 VSNSCSPGDPLVLERPPPR 37 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 11 VSNSCSPGDPLVLERPPPR 29 >SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 Q + NSCSPGDPLVLER R Sbjct: 1 QVIDTSNSCSPGDPLVLERPPPR 23 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/25 (68%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 88 PQTVLVP-NSCSPGDPLVLERAAHR 17 P T P NSCSPGDPLVLER R Sbjct: 38 PTTYAEPSNSCSPGDPLVLERPPPR 62 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -1 Query: 97 LI*PQTVLVPNSCSPGDPLVLERAAHR 17 +I +TVL NSCSPGDPLVLER R Sbjct: 13 IICSRTVL-SNSCSPGDPLVLERPPPR 38 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER+ R Sbjct: 34 ITSNSCSPGDPLVLERSPPR 53 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P + NSCSPGDPLVLER R Sbjct: 607 PPVHFLSNSCSPGDPLVLERPPPR 630 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 31 ALELVDPPGCRNSAR 75 ALELVDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/32 (56%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -1 Query: 109 RVSP-LI*PQTVLVPNSCSPGDPLVLERAAHR 17 RV P L+ + NSCSPGDPLVLER R Sbjct: 239 RVLPSLVRATAINASNSCSPGDPLVLERPPPR 270 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 5 ISNSCSPGDPLVLERTPPR 23 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 5 VISNSCSPGDPLVLERPPPR 24 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 QT NSCSPGDPLVLER R Sbjct: 18 QTKQSSNSCSPGDPLVLERPPPR 40 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 17 VISNSCSPGDPLVLERPPPR 36 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -1 Query: 103 SPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 +P+ P NSCSPGDPLVLER R Sbjct: 100 NPIRFPFNGFTSNSCSPGDPLVLERPPPR 128 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 23 VSNSCSPGDPLVLERPPPR 41 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 3 LASNSCSPGDPLVLERPPPR 22 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 31 ALELVDPPGCRNSARG 78 ALELVDPPGCRNS G Sbjct: 88 ALELVDPPGCRNSIAG 103 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 661 LASNSCSPGDPLVLERPPPR 680 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T + NSCSPGDPLVLER R Sbjct: 3 TSKISNSCSPGDPLVLERPPPR 24 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 7 LASNSCSPGDPLVLERPPPR 26 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = -3 Query: 101 PTNITPNS--PRAEFLQPGGSTSSRA 30 P++++P P EFLQPGGSTSSRA Sbjct: 16 PSHLSPPGYWPEIEFLQPGGSTSSRA 41 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 11 IVASNSCSPGDPLVLERPPPR 31 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 31 ALELVDPPGCRNSARG 78 ALELVDPPGCRNS G Sbjct: 99 ALELVDPPGCRNSITG 114 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 L NSCSPGDPLVLER R Sbjct: 96 LASNSCSPGDPLVLERPPPR 115 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V+ NSCSPGDPLVLER R Sbjct: 67 VIESNSCSPGDPLVLERPPPR 87 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -3 Query: 101 PTNITPNSPRAEFLQPGGSTSSRA 30 P P P EFLQPGGSTSSRA Sbjct: 24 PNEPLPPLPDIEFLQPGGSTSSRA 47 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T+ NSCSPGDPLVLER R Sbjct: 180 TIPPSNSCSPGDPLVLERPPPR 201 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 +L NSCSPGDPLVLER R Sbjct: 24 LLPSNSCSPGDPLVLERPPPR 44 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P + NSCSPGDPLVLER R Sbjct: 76 PLSRFTSNSCSPGDPLVLERPPPR 99 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 T NSCSPGDPLVLER R Sbjct: 11 TSFTSNSCSPGDPLVLERPPPR 32 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P + NSCSPGDPLVLER R Sbjct: 57 PTAKKLSNSCSPGDPLVLERPPPR 80 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 76 LVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 13 ILSNSCSPGDPLVLERPPPR 32 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P NSCSPGDPLVLER R Sbjct: 18 PSVASQSNSCSPGDPLVLERPPPR 41 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 83 NSPRAEFLQPGGSTSSRA 30 N P EFLQPGGSTSSRA Sbjct: 38 NRPDIEFLQPGGSTSSRA 55 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 ++ NSCSPGDPLVLER R Sbjct: 19 LITSNSCSPGDPLVLERPPPR 39 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 59 ISNSCSPGDPLVLERPPPR 77 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 67 NSCSPGDPLVLERAAHR 17 NSCSPGDPLVLER+ R Sbjct: 44 NSCSPGDPLVLERSPPR 60 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 13 ISNSCSPGDPLVLERPPPR 31 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 31 ALELVDPPGCRNSARGLF 84 ALELVDPPGCRNS + F Sbjct: 12 ALELVDPPGCRNSMKQRF 29 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 79 VLVPNSCSPGDPLVLERAAHR 17 V NSCSPGDPLVLER R Sbjct: 78 VATSNSCSPGDPLVLERPPPR 98 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 88 PQTVLVPNSCSPGDPLVLERAAHR 17 P L NSCSPGDPLVLER R Sbjct: 23 PGKHLPSNSCSPGDPLVLERPPPR 46 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 152 ISNSCSPGDPLVLERPPPR 170 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -3 Query: 80 SPRAEFLQPGGSTSSRA 30 +P+ EFLQPGGSTSSRA Sbjct: 49 APKIEFLQPGGSTSSRA 65 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 47 ISNSCSPGDPLVLERPPPR 65 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/49 (40%), Positives = 27/49 (55%) Frame = -1 Query: 163 SVGFRVSIHF*SLRHSEFRVSPLI*PQTVLVPNSCSPGDPLVLERAAHR 17 SVG +V I L + + + ++ + NSCSPGDPLVLER R Sbjct: 772 SVGAKVKIALMGLIYRKIFLRVML---VAISSNSCSPGDPLVLERPPPR 817 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 83 NSPRAEFLQPGGSTSSRA 30 N R EFLQPGGSTSSRA Sbjct: 61 NGQRIEFLQPGGSTSSRA 78 >SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 85 QTVLVPNSCSPGDPLVLERAAHR 17 Q + NSCSPGDPLVLER R Sbjct: 5 QVIQGSNSCSPGDPLVLERPPPR 27 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 31 ALELVDPPGCRNSARG 78 ALELVDPPGCRNS G Sbjct: 29 ALELVDPPGCRNSIDG 44 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 18 ISNSCSPGDPLVLERPPPR 36 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 82 TVLVPNSCSPGDPLVLERAAHR 17 + + NSCSPGDPLVLER R Sbjct: 2419 SAIASNSCSPGDPLVLERPPPR 2440 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 73 VPNSCSPGDPLVLERAAHR 17 + NSCSPGDPLVLER R Sbjct: 974 ISNSCSPGDPLVLERPPPR 992 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,666,993 Number of Sequences: 59808 Number of extensions: 637772 Number of successful extensions: 3795 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3793 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -