BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20633 (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0144 + 1089090-1091390 28 7.6 01_01_0691 - 5328169-5328228,5328300-5328488,5328611-5328768,532... 28 7.6 >06_01_0144 + 1089090-1091390 Length = 766 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -2 Query: 540 GNAYYAMVIMTNWPFNINDSVITLT---WSSVVNEQFVF 433 GN YA +TN + ++ +++LT W +VV VF Sbjct: 391 GNVLYAFKSLTNDNYAVSSGILSLTKCLWKNVVRSPLVF 429 >01_01_0691 - 5328169-5328228,5328300-5328488,5328611-5328768, 5329677-5329767,5330359-5330438,5330472-5330533, 5330603-5330730,5331290-5331508,5331586-5331715, 5331804-5331870,5331968-5332062,5332150-5332221, 5332307-5332362,5332485-5332554,5332662-5332735, 5332820-5332954,5334135-5334314 Length = 621 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 285 QIYRSRRLASYVH*LRFSGASALHVLL 365 Q+Y RR++S H R SGA+AL V L Sbjct: 82 QVYVGRRISSPTHGNRNSGANALEVAL 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,421,081 Number of Sequences: 37544 Number of extensions: 234867 Number of successful extensions: 415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -