BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20633 (664 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022984-2|AAB69952.1| 521|Caenorhabditis elegans Hypothetical ... 28 5.1 AF038608-14|AAT92087.1| 314|Caenorhabditis elegans Serpentine r... 28 6.8 >AF022984-2|AAB69952.1| 521|Caenorhabditis elegans Hypothetical protein ZK488.5 protein. Length = 521 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 359 STRRLISMTNASDLRSP*GNADESANTNCSF 451 ST + IS TNA LRSP +TNC + Sbjct: 79 STSQFISSTNAPALRSPENKIFPQNSTNCPY 109 >AF038608-14|AAT92087.1| 314|Caenorhabditis elegans Serpentine receptor, class z protein83 protein. Length = 314 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 565 AFVSCIAFVF*VLAKQISMITSHFFTPV 648 AF + F F L KQ+S+I HFF V Sbjct: 123 AFQQFLVFYFPKLEKQVSIIQKHFFKDV 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,893,820 Number of Sequences: 27780 Number of extensions: 225142 Number of successful extensions: 480 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -