BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20629 (571 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0209 - 19073147-19074041,19074117-19074163,19074258-190744... 28 4.6 01_06_0541 - 30088910-30089107,30089421-30089477,30089563-300897... 27 8.0 >05_04_0209 - 19073147-19074041,19074117-19074163,19074258-19074437, 19074839-19074955,19075105-19075227,19075391-19075776, 19076177-19076303,19077140-19077202,19078035-19078086, 19078189-19080023 Length = 1274 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +2 Query: 164 NNDTRYNSGGRSYNTSRDRVDESYKKTYRNEALLTIQTESMEVEEDHQKEKE 319 NND N G S + D V Y E + E E EE+ ++E++ Sbjct: 685 NNDAHANEGPASVDNDADSVQSYLANKYTAEQEEEEEEEEEEEEEEEEEEED 736 >01_06_0541 - 30088910-30089107,30089421-30089477,30089563-30089721, 30090639-30090777,30090863-30091247,30091612-30091816 Length = 380 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 167 NDTRYNSGGRSYNTSRDRVDESYKKTYRNEALLTIQTESMEVEE 298 N R++ GR Y RD T +EAL E+++VEE Sbjct: 164 NYERHSGTGRGYEMKRDGAGRGNWGTATDEALAQETEEALKVEE 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,777,727 Number of Sequences: 37544 Number of extensions: 189733 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -